CAZyme Information: MGYG000000331_00432

Basic Information

• Species: Collinsella sp900544995
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp900544995
• CAZyme ID: MGYG000000331_00432
• CAZy Family: CE8
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
720	MGYG000000331_8|CGC1	79079.73	4.8253

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000331	2076395	MAG	Sweden	Europe

• Gene Location: Start: 16992; End: 19154 Strand: -

Full Sequence      

MNESIYTLRVSRAAEGAYPAISDALAAVDRLYPDAEQPVMIRIDPGEYRERVEIRRPHVT
IEGETADSVRIVGCLAAQMPSEDGSGQDGKLGTFRTYTVLVDADDVTLANLTIENDAGDG
REVGQAIALYADGDRLVVDACCIKGHQDTLFLGPLPPHEAKPGGFIGPKQYAPRRVGRQY
FRRCRIEGDVDFIFGGARAYFEGCEIRSLNRDMDVNGYVTAASTPEGEPYGFVFHGCSFT
APDDVAPDSVYLGRPWREWAQTVLIDCWLGQHIKREGWWDWNKPAAHERARYVGASLHGP
AGDAAGWAPWVRELDATAAARYAREQVLAGADGWDPEGGDGDAVETASLSDSGRTVHIDI
YYEDEPALRDRLKREGRSAAFKGATPGDFEAWQIATRDRLFDLLGLSIMDRAPIEVRELD
RVQIAGGIVRTHAMLQVERDVWMPFYLLEPQTPKFDAHGCKRCYICPHGHQGAGAASVAG
VTGVPAVDDAVRKFNYDYGLRLARMGYVTVCPDSRGWGSRRDWKGQGDDENSYLRGTCLN
QARMAEPLGLTVAGLNAWDNMRLIDYLETRGDIAMDDLGCFGFSGGGYMTLYLAALDPRV
RKAFVSGYLYGVDDSLLHLNGNCSCNYTPGLWRLLDMGDIASLIAPRPLLVQSCEKDHLN
GARGLANVDEQLSIVRDAYGLVGHADDLLHEVCPGGHHLGVAYLAEDIEWLDGHAARARS

Enzyme Prediction     

No EC number prediction in MGYG000000331_00432.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE8	10	329	2.3e-80	0.9826388888888888
CE19	463	697	1.1e-25	0.5783132530120482

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG4677	PemB	3.49e-65	6	330	81	404	Pectin methylesterase and related acyl-CoA thioesterases [Carbohydrate transport and metabolism, Lipid transport and metabolism].
pfam01095	Pectinesterase	2.18e-47	16	282	10	246	Pectinesterase.
PLN02708	PLN02708	4.68e-41	10	336	245	550	Probable pectinesterase/pectinesterase inhibitor
PLN02990	PLN02990	2.21e-40	10	337	263	562	Probable pectinesterase/pectinesterase inhibitor
PLN02432	PLN02432	6.74e-40	8	332	13	290	putative pectinesterase

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIA34433.1	0.0	1	716	1	716
ATP54718.1	0.0	10	716	10	716
QUC03567.1	0.0	8	719	7	713
QRP39805.1	4.50e-101	8	336	18	349
ASN95501.1	4.50e-101	8	336	18	349

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3UW0_A	1.85e-27	1	289	26	311	Pectinmethylesterase from Yersinia enterocolitica [Yersinia enterocolitica subsp. enterocolitica 8081]
2NSP_A	1.56e-25	6	289	4	287	ChainA, Pectinesterase A [Dickeya dadantii 3937],2NSP_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NST_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NST_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT6_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT6_B Chain B, Pectinesterase A [Dickeya dadantii 3937],2NT9_A Chain A, Pectinesterase A [Dickeya dadantii 3937],2NT9_B Chain B, Pectinesterase A [Dickeya dadantii 3937]
1XG2_A	2.47e-25	10	300	7	267	ChainA, Pectinesterase 1 [Solanum lycopersicum]
5C1E_A	1.08e-24	14	278	15	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Penultimately Deglycosylated Form (N-acetylglucosamine Stub at Asn84) [Aspergillus niger ATCC 1015]
5C1C_A	1.98e-24	14	278	15	245	CrystalStructure of the Pectin Methylesterase from Aspergillus niger in Deglycosylated Form [Aspergillus niger ATCC 1015]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GXA1	5.48e-35	10	337	260	559	Probable pectinesterase/pectinesterase inhibitor 23 OS=Arabidopsis thaliana OX=3702 GN=PME23 PE=2 SV=3
Q9LVQ0	7.23e-30	8	314	7	282	Pectinesterase 31 OS=Arabidopsis thaliana OX=3702 GN=PME31 PE=1 SV=1
Q9FJ21	9.62e-30	10	330	262	555	Probable pectinesterase/pectinesterase inhibitor 58 OS=Arabidopsis thaliana OX=3702 GN=PME58 PE=2 SV=1
Q43062	3.72e-28	10	330	211	505	Pectinesterase/pectinesterase inhibitor PPE8B OS=Prunus persica OX=3760 PE=2 SV=1
Q43043	4.39e-28	10	282	61	303	Pectinesterase OS=Petunia integrifolia OX=4103 GN=PPE1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000058	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000331_00432.