CAZyme Information: MGYG000000333_00191

Basic Information

• Species: Collinsella sp002232035
• Lineage: Bacteria; Actinobacteriota; Coriobacteriia; Coriobacteriales; Coriobacteriaceae; Collinsella; Collinsella sp002232035
• CAZyme ID: MGYG000000333_00191
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1718	MGYG000000333_7|CGC1	184404.35	4.2849

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000333	2036327	MAG	Sweden	Europe

• Gene Location: Start: 6667; End: 11823 Strand: +

Full Sequence      

MRANVDNLKKFTEYANSKGVSTGLWTQSNLEPDSNPETPWHLLRDFDAEVKTGGITTLKT
DVAWVGSGYSFGLNGIKTAYDTVTTGANKRPNIITLDGWAGTQRFGGIWTGDQYGGNWEY
IRFHIPTYIGQSLSGNPNIGSDMDGIFGGDPIISARDYQWKTFTPSMLDMDGWGTYRKSP
MTHGDPYTGISRFYLKLKAQLMPYIYTSAASAANIDTGNGDAGLPMIRAMLLSDNSEYAA
STSTQYQYMFGENFLVAPVYQDTQADENGNDIRNGIYLPNYGTDENPTIWIDYFSGKQYR
GGQVLNNYEAPLWKLPLFVKANAIVPMYAENNNPEAVSDTNTKGTDRSQRIVEFFATEGD
GTFTQYEDDGSSIENNTTEDDSYGTIDNISYGEHVSTVYSSKAAGGTATFTAEASQGGYN
GYDSNRTTTFVANVSAKPTSVVAKNGGSALNVVEVDSQETFDAATPEAGQAVYFYSETPN
LNHYGSDADGTEAEQGESFNNTKITTNPKVYVKFAKTDVAAAAQTLELGGFVNADATLTA
DRLNENLSAPTNLAAPEDATTPTSIKLTWGKVDGATSYDLKVDGTVFAVGDAAEFTHTDL
AYNSKHTYQIRSRNAEGYSAWSDVLEANSALDPWRNVPDAEEITWEGSLYGSHKAELAFD
HEFQSGDGGFHSGGNDLGKALTVDYGRAYKLDKLEYYPRDDAGNGTVTKMRVETSLDGVH
WTSQEVDWARSADCKTVAFDGTVAARYVRMTPLASVGNFFSASEIAIYKTDGTDGFAVGS
NLNKATISDGDYSNMKNYLGLENREPDTPTFGSQIRDHFADLNDNGVYDVYDYSFTMAGL
DGGTKQKGKVAGSLAVIPSKTEVEAGDEITVDVYAADAKNVNALGALVNFKSDQFEFVSE
SIAQDGSTAGMENLSREKVQFVDGTQTINLAFANRGDGKLYNGTGAVASFKLKAKTAGKV
ELPSTSWLIGPACDALEFASDGTVTMPDVPQPTVAEYAQDAFNITMTNDELTTDDGTNVE
KLIQQKSYNALFDNNEGDNGFEFLWNWSGNWDSEGKLPSYVKLPTTMTFAFKTPSKLDSV
EVVNRNGGNGTVQKIKAVVTFEDGSIQEFAGGEYDSFLARYAFDLSAENKGKKATKVEVT
PLEASGDQMLTLREVNFNYTQGVEAIEGVELGKNQTEFFEGDITPVDAKATPESAGYPYV
TVESSDPSVVSVSAVQAGDSVSYYLRANKAGKAKITVASVLDPSKTASYEVEVKAGVDTS
ALVAALSKAAGYSESVYTKDSYAALTTAVEAARKLLDSGQGSYSKKDVADATAKIEKAID
GLKMRPVDEKILINTPENRKNVKVADFSSEADYEGSNAVNALDGDERTLWHSDWAHGTGM
PQYLSVDLGRDYDLTDVTFLPRQDGGTNGDIFEAEILVSDAADGYEMGTAASMGTFAFDN
DGRVLTDRGDWKQMSFGAARGRYVTVKVIHAGGGDVDAYCSMAELKFYGTAVPDPVAKDD
LATAIEKVDAEVAAGDLKAGDYTEASWTALENALASARAILSDEDATQDEVDQALRALES
ARGALEKTPVVPVENPTKKQLKALVKQAKETDTRGKTDESVKTLTDAITYAEDILGDENA
SDTQLQAAYDQLKLAIESLRDADSGNQGGSGNQGSGNGSNGGNQAGKPAGDKAQGSKKNG
SAIPNTGDQTAATVVTVGGLGAIIAAIGAFFHRRSKAK

Enzyme Prediction     

No EC number prediction in MGYG000000333_00191.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	71	325	2.1e-49	0.5409836065573771

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06596	GH31_CPE1046	2.68e-119	5	296	80	334	Clostridium CPE1046-like. CPE1046 is an uncharacterized Clostridium perfringens protein with a glycosyl hydrolase family 31 (GH31) domain. The domain architecture of CPE1046 and its orthologs includes a C-terminal fibronectin type 3 (FN3) domain and a coagulation factor 5/8 type C domain in addition to the GH31 domain. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	7.70e-49	9	373	395	710	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
pfam01055	Glyco_hydro_31	2.85e-47	9	325	159	442	Glycosyl hydrolases family 31. Glycosyl hydrolases are key enzymes of carbohydrate metabolism. Family 31 comprises of enzymes that are, or similar to, alpha- galactosidases.
cd08759	Type_III_cohesin_like	8.60e-37	852	1019	1	167	Cohesin domain, interaction partner of dockerin. Bacterial cohesin domains bind to a complementary protein domain named dockerin, and this interaction is required for the formation of the cellulosome, a cellulose-degrading complex. Two specific calcium-dependent interactions between cohesin and dockerin appear to be essential for cellulosome assembly, type I and type II. This subfamily represents type III cohesins and closely related domains.
cd06603	GH31_GANC_GANAB_alpha	5.32e-32	88	327	211	428	neutral alpha-glucosidase C, neutral alpha-glucosidase AB. This subgroup includes the closely related glycosyl hydrolase family 31 (GH31) isozymes, neutral alpha-glucosidase C (GANC) and the alpha subunit of heterodimeric neutral alpha-glucosidase AB (GANAB). Initially distinguished on the basis of differences in electrophoretic mobility in starch gel, GANC and GANAB have been shown to have other differences, including those of substrate specificity. GANC and GANAB are key enzymes in glycogen metabolism that hydrolyze terminal, non-reducing 1,4-linked alpha-D-glucose residues from glycogen in the endoplasmic reticulum. The GANC/GANAB family includes the alpha-glucosidase II (ModA) from Dictyostelium discoideum as well as the alpha-glucosidase II (GLS2, or ROT2 - Reversal of TOR2 lethality protein 2) from Saccharomyces cerevisiae.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWT17625.1	0.0	3	1653	438	2114
QNM10857.1	0.0	3	1644	421	2019
BCT46261.1	0.0	3	1641	427	2041
BBK61154.1	0.0	3	1647	432	2075
QOY60737.1	0.0	170	1024	1	848

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6M76_A	1.38e-139	4	635	378	963	GH31alpha-N-acetylgalactosaminidase from Enterococcus faecalis [Enterococcus faecalis ATCC 10100],6M77_A GH31 alpha-N-acetylgalactosaminidase from Enterococcus faecalis in complex with N-acetylgalactosamine [Enterococcus faecalis ATCC 10100]
7F7R_A	6.87e-139	4	635	378	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
7F7Q_A	1.80e-138	4	635	378	963	ChainA, GH31 alpha-N-acetylgalactosaminidase [Enterococcus faecalis ATCC 10100]
4LPL_A	8.02e-22	614	769	23	182	Structureof CBM32-1 from a family 31 glycoside hydrolase from Clostridium perfringens [Clostridium perfringens ATCC 13124]
7KMP_A	4.97e-19	88	370	636	901	ChainA, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306],7KNC_A Chain A, Alpha-xylosidase [Xanthomonas citri pv. citri str. 306]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q9F234	8.33e-20	89	373	461	714	Alpha-glucosidase 2 OS=Bacillus thermoamyloliquefaciens OX=1425 PE=3 SV=1
Q9FN05	1.14e-18	90	326	566	780	Probable glucan 1,3-alpha-glucosidase OS=Arabidopsis thaliana OX=3702 GN=PSL5 PE=1 SV=1
B9F676	2.58e-18	78	326	551	778	Probable glucan 1,3-alpha-glucosidase OS=Oryza sativa subsp. japonica OX=39947 GN=Os03g0216600 PE=3 SV=1
P38138	1.05e-15	71	327	570	811	Glucosidase 2 subunit alpha OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ROT2 PE=1 SV=1
A7LXT0	1.80e-15	88	370	605	879	Alpha-xylosidase BoGH31A OS=Bacteroides ovatus (strain ATCC 8483 / DSM 1896 / JCM 5824 / BCRC 10623 / CCUG 4943 / NCTC 11153) OX=411476 GN=BACOVA_02646 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
1690	1712