CAZyme Information: MGYG000000334_00191

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA5446
• CAZyme ID: MGYG000000334_00191
• CAZy Family: GH94
• CAZyme Description: Cyclic beta-(1,2)-glucan synthase NdvB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
605	MGYG000000334_14|CGC1	66176.63	5.7098

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000334	2196649	MAG	Sweden	Europe

• Gene Location: Start: 7681; End: 9498 Strand: -

Full Sequence      

MAGMWLGNARELRIDKGLDSDLALEGSESLRLEGENAFLRSKMRFGFGYAEWRRGKMRIT
AFVPQHIDARLLLIENAPAGLVWTLRPALAWERRDAAFTQTRLEGGVLRASNPRGGDPGL
DFGAAFTQAEGLACEYAGRPVFTARLGAGTCVIACGALPSDELQSLCEPEQARRLLSETR
FHWQQLASRSKICTGIPELDRYLDGWALYQALACRLLARTSIYQSGGAYGFRDQLQDAVN
LLAVEPAWARERIIAACAHQYREGDVMHWWHAGEPDRGVRTRCSDDLVWLPWAVCEYLGK
VGDTSILYEPVPYLRSEKLAEGEPSRYEPAVPEGSGTVLEHAALALRLVIRRGVGRHGLP
LMLAGDWNDGMDTVGIDGRGESVWLAWFFAHTARRFAHVLEGSGDKHGAAALLSAASRLG
RAADRAWDGQWYLRGYFDDGSPLGSGRGHGCRIDSVAQSWAAFCAEASPERVDTALDSAL
ERLFDREAGLVKLFDPPFGEGAERAGYIASYGPGFRENGGQSTLGALGLALACLKRGRRD
ECIGLLRALLPKESETYGAEPYVLAADVYTNPDRPGQAGWSWYTGSAGWFFRIASELASD
GGPGE

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH94	164	596	2e-144	0.4083011583011583

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3459	COG3459	2.63e-124	41	596	368	977	Cellobiose phosphorylase [Carbohydrate transport and metabolism].
pfam17167	Glyco_hydro_36	1.59e-93	182	596	1	419	Glycosyl hydrolase 36 superfamily, catalytic domain. This is the catalytic region of the superfamily of enzymes referred to as GH36. UniProtKB:Q76IQ9 is a chitobiose phosphorylase that catalyzes the reversible phosphorolysis of chitobiose into alpha-GlcNAc-1-phosphate and GlcNAc with inversion of the anomeric configuration. The full-length enzyme comprises a beta sandwich domain and an (alpha/alpha)(6) barrel domain. The alpha-helical barrel component of the domain, this family, is the catalytic region.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QBB66089.1	2.43e-143	4	596	1766	2325
ABQ91109.1	2.74e-122	6	596	2152	2764
AWM37287.1	2.33e-121	168	596	2269	2703
VTS09285.1	2.34e-121	168	596	2314	2748
QXD15157.1	4.05e-120	4	596	382	1051

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3QDE_A	4.01e-34	170	596	295	730	ChainA, Cellobiose phosphorylase [Acetivibrio thermocellus],3QDE_B Chain B, Cellobiose phosphorylase [Acetivibrio thermocellus]
2CQS_A	1.02e-32	170	596	322	763	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Ammonium Sulfate [Cellulomonas gilvus],2CQT_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],2CQT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Crystallized from Sodium/Potassium Phosphate [Cellulomonas gilvus],3QFY_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFY_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and Isofagomine [Cellulomonas gilvus],3QFZ_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QFZ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Sulfate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_A Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus],3QG0_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Complexed with Phosphate and 1-Deoxynojirimycin [Cellulomonas gilvus]
3ACT_A	1.02e-32	170	596	322	763	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127],3ACT_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase Histidine mutant [Cellulomonas gilvus ATCC 13127]
3AFJ_A	1.02e-32	170	596	322	763	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127],3AFJ_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase triple mutant [Cellulomonas gilvus ATCC 13127]
3ACS_A	1.83e-31	170	596	322	763	CrystalStructure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127],3ACS_B Crystal Structure of Cellvibrio gilvus Cellobiose Phosphorylase W488F mutant [Cellulomonas gilvus ATCC 13127]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20471	6.66e-105	47	596	2200	2765	Cyclic beta-(1,2)-glucan synthase NdvB OS=Rhizobium meliloti (strain 1021) OX=266834 GN=ndvB PE=1 SV=2
B9K7M6	2.01e-36	170	596	296	732	Cellobiose phosphorylase OS=Thermotoga neapolitana (strain ATCC 49049 / DSM 4359 / NBRC 107923 / NS-E) OX=309803 GN=cbpA PE=1 SV=1
Q76IQ9	1.25e-30	180	597	294	723	N,N'-diacetylchitobiose phosphorylase OS=Vibrio proteolyticus OX=671 GN=chbP PE=1 SV=1
Q9F8X1	1.23e-28	182	597	296	722	N,N'-diacetylchitobiose phosphorylase OS=Vibrio furnissii OX=29494 GN=chbP PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000035	0.000004	0.000001	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000334_00191.