CAZyme Information: MGYG000000335_01232

Basic Information

• Species: Enterococcus_G italicus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_G; Enterococcus_G italicus
• CAZyme ID: MGYG000000335_01232
• CAZy Family: GH73
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
279		30338.82	5.7403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000335	1887038	MAG	Sweden	Europe

• Gene Location: Start: 3068; End: 3907 Strand: -

Full Sequence      

MVVKTRSERHIKNIDPRKSPLKNMVPLVGIAMVGAPTVISLAPSTVYANEDGVANAQSLI
NQIGTAASEIANQNDLYASVMIAQALLESGNGSSVLSSAPYYNLFGVKAYNGGATVWLPT
QEYLNGQWVTMTEPFRQYNSYYESLVDHANVLLASSSVTGQARYAGAWKSQTTSYYDATA
YLTGRYATDPNYNQKLNSLIQRYNLTQYDTPSYYTQTTTTTTTTTTTTTTTYQATATYTV
AQGDTLWGIAQKFGVSVDQLVAQNNISGELIVVGQQLSI

Enzyme Prediction     

EC	3.2.1.-	3.2.1.17	3.2.1.96

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH73	64	205	2.1e-29	0.984375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK06347	PRK06347	2.41e-56	54	279	148	374	1,4-beta-N-acetylmuramoylhydrolase.
COG1705	FlgJ	6.13e-56	37	210	27	189	Flagellum-specific peptidoglycan hydrolase FlgJ [Cell wall/membrane/envelope biogenesis, Cell motility].
PRK08581	PRK08581	2.66e-47	60	211	324	474	amidase domain-containing protein.
smart00047	LYZ2	2.16e-30	55	209	7	147	Lysozyme subfamily 2. Eubacterial enzymes distantly related to eukaryotic lysozymes.
pfam01832	Glucosaminidase	2.63e-19	64	148	1	77	Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase. This family includes Mannosyl-glycoprotein endo-beta-N-acetylglucosaminidase EC:3.2.1.96. As well as the flageller protein J that has been shown to hydrolyze peptidoglycan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCA85782.1	6.78e-99	4	279	5	298
AYW44979.1	5.36e-95	1	279	1	295
QOG27463.1	7.75e-95	5	277	6	283
AYY10696.1	7.75e-95	5	277	6	283
ASZ07706.1	4.35e-94	3	279	4	295

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3FI7_A	5.46e-35	57	209	31	183	CrystalStructure of the autolysin Auto (Lmo1076) from Listeria monocytogenes, catalytic domain [Listeria monocytogenes EGD-e]
5T1Q_A	3.37e-29	55	209	59	212	ChainA, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_B Chain B, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_C Chain C, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325],5T1Q_D Chain D, N-acetylmuramoyl-L-alanine amidase domain-containing protein SAOUHSC_02979 [Staphylococcus aureus subsp. aureus NCTC 8325]
5DN5_A	7.36e-14	55	202	2	147	Structureof a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_B Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],5DN5_C Structure of a C-terminally truncated glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
5DN4_A	9.98e-14	55	202	2	147	Structureof the glycoside hydrolase domain from Salmonella typhimurium FlgJ [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3VWO_A	5.20e-13	56	207	1	150	Crystalstructure of peptidoglycan hydrolase mutant from Sphingomonas sp. A1 [Sphingomonas sp. A1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P37710	6.09e-63	60	277	184	402	Autolysin OS=Enterococcus faecalis (strain ATCC 700802 / V583) OX=226185 GN=EF_0799 PE=1 SV=2
P39046	4.40e-61	6	279	6	298	Muramidase-2 OS=Enterococcus hirae (strain ATCC 9790 / DSM 20160 / JCM 8729 / LMG 6399 / NBRC 3181 / NCIMB 6459 / NCDO 1258 / NCTC 12367 / WDCM 00089 / R) OX=768486 GN=EHR_05900 PE=1 SV=1
Q9CIT4	1.76e-55	55	277	61	282	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. lactis (strain IL1403) OX=272623 GN=acmA PE=3 SV=1
A2RHZ5	1.29e-54	55	277	61	284	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris (strain MG1363) OX=416870 GN=acmA PE=3 SV=1
P0C2T5	5.03e-54	55	277	61	284	Probable N-acetylmuramidase OS=Lactococcus lactis subsp. cremoris OX=1359 GN=acmA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.006231	0.992668	0.000306	0.000331	0.000228	0.000205

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000335_01232.