CAZyme Information: MGYG000000335_01422

Basic Information

• Species: Enterococcus_G italicus
• Lineage: Bacteria; Firmicutes; Bacilli; Lactobacillales; Enterococcaceae; Enterococcus_G; Enterococcus_G italicus
• CAZyme ID: MGYG000000335_01422
• CAZy Family: GH170
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354		40606.4	6.2444

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000335	1887038	MAG	Sweden	Europe

• Gene Location: Start: 691; End: 1755 Strand: -

Full Sequence      

MYGFSFYLNDDVDQFCDSYLSSMREVGFSGIFTSLHIPEEDASKYRQRLADLGVLARKYH
FTLMVDVSSGALAKAGFNKNPIMDLLAMGITGLRMDDGFSMEMVAEFSHQLQIGLNASTI
TEEEIKQLHEFAANFSNLSAWHNYYPRPETGLEREWFVRKNQWLKDNGLKVQAFISGDDE
KRGPLKVGLPTLEEHRHRLPLAAALDLQQLGVDFVYIGDPSLSKRSQSQFQAWVKNKRLL
VFCENIKEIYRDIVLNVHHNRPDVARDVVRSREARGRMTNRVLPLQSLERKLGSITIDNY
FYGRYMGELQLCKVDLPMDSRVNVIGNIVQKDLSLLPFIGANIEFELIEEEVKQ

Enzyme Prediction     

No EC number prediction in MGYG000000335_01422.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH170	1	347	1.7e-120	0.9942857142857143

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3589	COG3589	1.03e-111	1	351	3	360	Uncharacterized protein [Function unknown].
pfam19200	DUF871_N	1.70e-101	3	230	2	233	DUF871 N-terminal domain. This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
pfam05913	DUF871	1.06e-36	242	348	7	116	Bacterial protein of unknown function (DUF871). This family consists of several conserved hypothetical proteins from bacteria and archaea. The function of this family is unknown.
cd06565	GH20_GcnA-like	0.005	64	135	5	72	Glycosyl hydrolase family 20 (GH20) catalytic domain of N-acetyl-beta-D-glucosaminidase (GcnA, also known as BhsA) and related proteins. GcnA is an exoglucosidase which cleaves N-acetyl-beta-D-galactosamine (NAG) and N-acetyl-beta-D-galactosamine residues from 4-methylumbelliferylated (4MU) substrates, as well as cleaving NAG from chito-oligosaccharides (i.e. NAG polymers). In contrast, sulfated forms of the substrate are unable to be cleaved and act instead as mild competitive inhibitors. Additionally, the enzyme is known to be poisoned by several first-row transition metals as well as by mercury. GcnA forms a homodimer with subunits comprised of three domains, an N-terminal zincin-like domain, this central catalytic GH20 domain, and a C-terminal alpha helical domain. The GH20 hexosaminidases are thought to act via a catalytic mechanism in which the catalytic nucleophile is not provided by solvent or the enzyme, but by the substrate itself.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEA60502.1	2.29e-117	1	351	1	350
AIS03849.1	2.29e-117	1	351	1	350
ALS00837.1	2.37e-117	1	350	1	351
QRZ11657.1	1.86e-116	1	351	1	350
QIT58302.1	1.06e-115	1	351	1	351

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2P0O_A	4.74e-102	2	350	5	360	Crystalstructure of a conserved protein from locus EF_2437 in Enterococcus faecalis with an unknown function [Enterococcus faecalis V583]
1X7F_A	1.57e-33	3	349	30	385	Crystalstructure of an uncharacterized B. cereus protein [Bacillus cereus ATCC 14579]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A0A0H2XHV5	2.86e-51	1	346	1	342	6-phospho-N-acetylmuramidase OS=Staphylococcus aureus (strain USA300) OX=367830 GN=mupG PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000335_01422.