CAZyme Information: MGYG000000337_00114

Basic Information

• Species: Morganella morganii_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Morganella; Morganella morganii_B
• CAZyme ID: MGYG000000337_00114
• CAZy Family: AA10
• CAZyme Description: GlcNAc-binding protein A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
192		21990	6.7441

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000337	3835549	MAG	Sweden	Europe

• Gene Location: Start: 461; End: 1039 Strand: +

Full Sequence      

MKKHIIITAVLASLFSASVLAHGYVTKPASRATNCKLNNNPPEMCGHAKWEPQSIETLSG
FPGGKFPPDGSLASGGIERFIPLDLVKDKIWTKEKVKPGKMDFEWTLTVVHSTRNWRYYI
TKQDWNHEVPLNREAFESEPFCYFEDYGRVPPYTVTHQCEVPERKGYQIIYAVWEIADTP
NSFYQVIDADFN

Enzyme Prediction     

No EC number prediction in MGYG000000337_00114.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
AA10	22	189	8.5e-50	0.9887640449438202

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13211	PRK13211	2.35e-89	1	192	3	194	N-acetylglucosamine-binding protein GbpA.
cd21177	LPMO_AA10	2.04e-64	22	190	1	180	lytic polysaccharide monooxygenase (LPMO) auxiliary activity family 10 (AA10). AA10 proteins are copper-dependent lytic polysaccharide monooxygenases (LPMOs), which may act on chitin or cellulose. The family used to be called CBM33. Activities in this family include lytic cellulose monooxygenase (C1-hydroxylating) (EC 1.14.99.54), lytic cellulose monooxygenase (C4-dehydrogenating) (EC 1.14.99.56), lytic chitin monooxygenase (EC 1.14.99.53), and lytic xylan monooxygenase/xylan oxidase (glycosidic bond-cleaving) (EC 1.14.99.-). Also included are viral chitin-binding glycoproteins such as fusolin and spheroidin-like proteins.
COG3397	COG3397	3.22e-59	1	192	1	208	Predicted carbohydrate-binding protein, contains CBM5 and CBM33 domains [General function prediction only].
pfam03067	LPMO_10	3.47e-53	22	188	1	185	Lytic polysaccharide mono-oxygenase, cellulose-degrading. This domain is found associated with a wide variety of cellulose binding domains. This is a family of two very closely related proteins that together act as both a C1- and a C4-oxidising lytic polysaccharide mono-oxygenase, degrading cellulose. This domain is also found in baculoviral spheroidins and spindolins, protein of unknown function.
cd21174	LPMO_auxiliary	4.40e-05	91	188	40	136	lytic polysaccharide monooxygenase auxiliary activity protein. Many proteins in this superfamily are copper-dependent lytic polysaccharide monooxygenases (LPMOs) and include lytic polysaccharide monooxygenase auxiliary activity families 9 (AA9) and 10 (AA10). The substrate-binding surface of this family is a flat beta-sandwich fold.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QXO50133.1	4.36e-86	1	192	1	191
QXO46405.1	4.36e-86	1	192	1	191
QXO42807.1	4.36e-86	1	192	1	191
QXO53996.1	4.36e-86	1	192	1	191
QXO80626.1	4.36e-86	1	192	1	191

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2BEM_A	9.90e-53	22	192	1	169	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2BEM_C Crystal structure of the Serratia marcescens chitin-binding protein CBP21 [Serratia marcescens],2LHS_A Structure of the chitin binding protein 21 (CBP21) [Serratia marcescens]
2BEN_A	5.66e-52	22	192	1	169	Crystalstructure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens],2BEN_B Crystal structure of the Serratia marcescens chitin-binding protein CBP21 Y54A mutant. [Serratia marcescens]
6T5Z_A	3.60e-46	22	188	1	168	Crystalstructure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_B Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1],6T5Z_C Crystal structure of an AA10 LPMO from Photorhabdus luminescens [Photorhabdus laumondii subsp. laumondii TTO1]
5WSZ_A	1.01e-44	22	190	1	165	Crystalstructure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_B Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_C Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki],5WSZ_D Crystal structure of a lytic polysaccharide monooxygenase,BtLPMO10A, from Bacillus thuringiensis [Bacillus thuringiensis serovar kurstaki]
2XWX_A	9.85e-43	22	192	1	179	Vibriocholerae colonization factor GbpA crystal structure [Vibrio cholerae],2XWX_B Vibrio cholerae colonization factor GbpA crystal structure [Vibrio cholerae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6LKG5	2.17e-53	13	192	16	203	GlcNAc-binding protein A OS=Photobacterium profundum (strain SS9) OX=298386 GN=gbpA PE=3 SV=1
Q8EHY2	7.03e-52	13	192	19	196	GlcNAc-binding protein A OS=Shewanella oneidensis (strain MR-1) OX=211586 GN=gbpA PE=3 SV=2
Q87FT0	6.63e-45	7	192	9	202	GlcNAc-binding protein A OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) OX=223926 GN=gbpA PE=3 SV=1
B5ESR7	7.18e-45	16	192	18	205	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain MJ11) OX=388396 GN=gbpA PE=3 SV=1
Q5E183	7.18e-45	16	192	18	205	GlcNAc-binding protein A OS=Aliivibrio fischeri (strain ATCC 700601 / ES114) OX=312309 GN=gbpA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000226	0.999168	0.000156	0.000150	0.000130	0.000122

TMHMM  Annotations     

start	end
4	26