CAZyme Information: MGYG000000337_00508

Basic Information

• Species: Morganella morganii_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Morganella; Morganella morganii_B
• CAZyme ID: MGYG000000337_00508
• CAZy Family: GH23
• CAZyme Description: Endo-type membrane-bound lytic murein transglycosylase A

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
226	MGYG000000337_15|CGC1	24641.82	9.3381

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000337	3835549	MAG	Sweden	Europe

• Gene Location: Start: 11393; End: 12073 Strand: -

Full Sequence      

MKKTVSVIALALLLAGCSGSSKQSRTGSGGWITPPSSGISDYSAYPVKGSGVYPATPFDQ
FIRQASNRYEVDETLIRAIIEVESSYRPDVISKSNAVGLMQIKASTAGRDAYRVKGRNGE
PSTRELLDPQTNIDIGTTYIRIIRDQHLAGITDPQTLNYATIVSYVNGAGALLRTFDNNR
ALAIEKINALSADEFYEHVQSKHPASQAPRYLWKVKNAYHALAMAD

Enzyme Prediction     

No EC number prediction in MGYG000000337_00508.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	71	222	5.4e-20	0.8148148148148148

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd16893	LT_MltC_MltE	2.01e-81	61	220	2	162	membrane-bound lytic murein transglycosylases MltC and MltE, and similar proteins. MltC and MltE are periplasmic, outer membrane attached lytic transglycosylases (LTs), which cleave beta-1,4-glycosidic bonds joining N-acetylmuramic acid and N-acetylglucosamine in the cell wall peptidoglycan, yielding 1,6-anhydromuropeptides. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda
PRK15470	emtA	1.31e-72	10	222	9	203	membrane-bound lytic murein transglycosylase EmtA.
PRK11671	mltC	8.47e-61	61	218	195	352	membrane-bound lytic murein transglycosylase MltC.
pfam01464	SLT	1.33e-29	62	187	1	114	Transglycosylase SLT domain. This family is distantly related to pfam00062. Members are found in phages, type II, type III and type IV secretion systems.
COG0741	MltE	3.04e-28	43	218	124	294	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QIC12138.1	6.12e-158	1	226	1	226
QWL98416.1	6.12e-158	1	226	1	226
AUR31738.1	6.12e-158	1	226	1	226
QXO40556.1	6.12e-158	1	226	1	226
VDY34036.1	6.12e-158	1	226	1	226

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2Y8P_A	4.95e-57	63	222	27	186	CrystalStructure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12],2Y8P_B Crystal Structure of an Outer Membrane-Anchored Endolytic Peptidoglycan Lytic Transglycosylase (MltE) from Escherichia coli [Escherichia coli K-12]
3T36_A	6.55e-57	63	222	44	203	Crystalstructure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_B Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_C Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_D Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],3T36_E Crystal structure of lytic transglycosylase MltE from Eschericha coli [Escherichia coli K-12],4HJV_A Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_B Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_C Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_D Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12],4HJV_E Crystal structure of E. coli MltE with bound bulgecin and murodipeptide [Escherichia coli K-12]
6GHY_A	1.41e-56	63	222	27	186	Structureof Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12],6GHY_B Structure of Lytic Transglycosylase MltE inactive mutant E64Q from E.coli [Escherichia coli K-12]
6GI3_B	1.41e-56	63	222	27	186	Structureof Lytic Transglycosylase MltE mutant S73A from E.coli [Escherichia coli]
6GI4_B	1.41e-56	63	222	27	186	Structureof Lytic Transglycosylase MltE mutant S75A from E.coli [Escherichia coli]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A8AFS5	7.34e-61	10	222	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) OX=290338 GN=emtA PE=3 SV=1
B5BI54	2.39e-59	10	222	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi A (strain AKU_12601) OX=554290 GN=emtA PE=3 SV=1
Q5PN08	2.39e-59	10	222	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) OX=295319 GN=emtA PE=3 SV=1
B5R2X1	2.39e-59	10	222	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella enteritidis PT4 (strain P125109) OX=550537 GN=emtA PE=3 SV=1
B5R901	2.39e-59	10	222	9	203	Endo-type membrane-bound lytic murein transglycosylase A OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) OX=550538 GN=emtA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000075	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000337_00508.