CAZyme Information: MGYG000000337_01995

Basic Information

• Species: Morganella morganii_B
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Enterobacteriaceae; Morganella; Morganella morganii_B
• CAZyme ID: MGYG000000337_01995
• CAZy Family: GH23
• CAZyme Description: Soluble lytic murein transglycosylase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
641	MGYG000000337_105|CGC1	72069.27	8.702

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000337	3835549	MAG	Sweden	Europe

• Gene Location: Start: 6386; End: 8311 Strand: +

Full Sequence      

MRKCIWPGVAALSMLMFSALASADSLSEQRQRYQDVKSAWDANNMAEVERLMPSLRDYPL
YPYLEYRELTQDMSLLTAGQVKHFTDTHPNLPSAASLKNKFISELAKRNDWQGLVSYSTT
VPKPVSAKCDYYYASWQTGNRQVALDGAKSVWLAGNSLPSSCDKLFDVWDQSGGLTPERI
LERISLALKNGNSSLVSYLAKRLPASYQTISNGLINLQKNPASVVTFAQLSPTDFTRQAT
ISAFSAYARKSPDAARADLNSVARAQKMNDSERQQLKDAVAWQYMGSDVTDEQAAWRDEV
IQETDSVTLRERRVRLALSNADDRDLDRWLTRLPADAQQKEEWQYWRAVLLEKGGNKAAA
DAILEKITQGRGFYPMVAAQRLGKPYIMMINAADKPDNSISNLPEIQRIRELLYWQMEGL
ARTEWLNLVDSQTPARKAQLARYALEQGWADLSVQATINGKLWDHLEERFPLAWQSEFDE
FTQNKNISKSYAMAIARQESAWNPQARSPVGATGLMQLMPATASQTVRDNGIADYSNSAQ
LVNPRKNIEIGTAYLNGVYNQFGQNRILASAAYNAGPNRVTRWLSNSGGRLDAVAFVETI
PFAETRGYVKNVLAFDVFYQNFLKGQRPADVLTPSEQSMRY

Enzyme Prediction     

No EC number prediction in MGYG000000337_01995.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH23	489	614	1.8e-29	0.762962962962963

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11619	PRK11619	0.0	9	641	13	644	lytic murein transglycosylase; Provisional
cd13401	Slt70-like	1.27e-66	469	620	1	150	70kDa soluble lytic transglycosylase (Slt70) and similar proteins. Catalytic domain of the 70kda soluble lytic transglycosylase (LT)-like proteins, which also have an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue. Proteins similar to this family include the soluble and insoluble membrane-bound LTs in bacteria and the LTs in bacteriophage lambda.
COG0741	MltE	5.02e-45	342	623	2	287	Soluble lytic murein transglycosylase and related regulatory proteins (some contain LysM/invasin domains) [Cell wall/membrane/envelope biogenesis].
cd16896	LT_Slt70-like	1.40e-38	486	615	16	143	uncharacterized lytic transglycosylase subfamily with similarity to Slt70. Uncharacterized lytic transglycosylase (LT) with a conserved sequence pattern suggesting similarity to the Slt70, a 70kda soluble lytic transglycosylase which also has an N-terminal U-shaped U-domain and a linker L-domain. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.
cd00254	LT-like	1.04e-34	493	614	5	108	lytic transglycosylase(LT)-like domain. Members include the soluble and insoluble membrane-bound LTs in bacteria and LTs in bacteriophage lambda. LTs catalyze the cleavage of the beta-1,4-glycosidic bond between N-acetylmuramic acid (MurNAc) and N-acetyl-D-glucosamine (GlcNAc), as do "goose-type" lysozymes. However, in addition to this, they also make a new glycosidic bond with the C6 hydroxyl group of the same muramic acid residue.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QWL89269.1	0.0	1	641	1	641
QPJ69043.1	0.0	1	641	1	641
QQO73002.1	0.0	1	641	1	641
QUI27226.1	0.0	1	641	1	641
AUR30276.1	0.0	1	641	1	641

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1QSA_A	5.50e-237	24	641	1	618	CrystalStructure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.65 Angstroms Resolution [Escherichia coli],1QTE_A Crystal Structure Of The 70 Kda Soluble Lytic Transglycosylase Slt70 From Escherichia Coli At 1.90 A Resolution In Complex With A 1,6- Anhydromurotripeptide [Escherichia coli]
1SLY_A	1.80e-235	24	641	1	618	ComplexOf The 70-Kda Soluble Lytic Transglycosylase With Bulgecin A [Escherichia coli]
5OHU_A	4.89e-89	1	628	1	630	TheX-ray Structure of Lytic Transglycosylase Slt from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
6FC4_A	3.85e-87	28	628	1	602	ChainA, Soluble lytic murein transglycosylase [Pseudomonas aeruginosa]
6FBT_A	6.85e-87	29	628	1	601	ChainA, Lytic murein transglycosylase [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P39434	1.79e-239	5	641	8	645	Soluble lytic murein transglycosylase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=slt PE=3 SV=2
P0AGC3	3.59e-239	2	641	5	645	Soluble lytic murein transglycosylase OS=Escherichia coli (strain K12) OX=83333 GN=slt PE=1 SV=1
P0AGC4	3.59e-239	2	641	5	645	Soluble lytic murein transglycosylase OS=Escherichia coli O157:H7 OX=83334 GN=slt PE=3 SV=1
P44888	1.56e-72	216	628	171	581	Putative soluble lytic murein transglycosylase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) OX=71421 GN=slt PE=3 SV=1
O31608	1.07e-13	487	619	73	180	Putative murein lytic transglycosylase YjbJ OS=Bacillus subtilis (strain 168) OX=224308 GN=yjbJ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000609	0.998151	0.000524	0.000247	0.000237	0.000211

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000337_01995.