CAZyme Information: MGYG000000338_00847

Basic Information

• Species: Anaerobiospirillum sp900543125
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Anaerobiospirillum; Anaerobiospirillum sp900543125
• CAZyme ID: MGYG000000338_00847
• CAZy Family: GH36
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
553	MGYG000000338_32|CGC1	62945.92	5.759

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000338	3410865	MAG	Sweden	Europe

• Gene Location: Start: 137; End: 1798 Strand: +

Full Sequence      

MPKTLIDVRLPVDNIQSLWLPSIQAPGKNYRAKGMLEYYANVTTHICHIAPMGAFYSAEG
INKLSFALSDCKNVVTLTGGAYEEEECARFTFTLFEAPSAPVSQYQVSLRLDSSAMNVFN
AVKNISRYYERSLNLDVMGVPEAALEPVYSTWYAFLQNLSAQEIEDQCAIAASLGCKTVI
VDDGWQTDDNNRGYSYCGDWEVSKRRFPDMKEHVAKVHALGMKYMLWFSVPFVGGKSKNG
PEYKDYSLCYNPRWGAYVLDPRYKKVRDFLVNTYVNTVKEYDLDGLKLDFIDEFDMRQAD
EKARAYDDKRDTQSLVDAVDMLMTEVRNALSAIKSDILIEFRQNYVGPMIRKYGNMFRAH
DCPNDTLMNRMTTCDVRAMALDTAVHSDMFTWSPSESVQSASLQFIHTLFSVPQISPNLK
HLNEDHLAMVKHWLSFCSAHRDLLLKGHMEAFHPEVMYSKMVGTLNNEQIIIVGNDQRVE
LFNNEAVDTTYLVNGAMLTSLVIKSTPEHQLNLKAEIFDCLGKQVQVIENLQLDSKLYEL
AMPKSGYVKFTKI

Enzyme Prediction     

No EC number prediction in MGYG000000338_00847.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH36	125	453	1.1e-36	0.48255813953488375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd14791	GH36	3.80e-70	144	436	1	296	glycosyl hydrolase family 36 (GH36). GH36 enzymes occur in prokaryotes, eukaryotes, and archaea with a wide range of hydrolytic activities, including alpha-galactosidase, alpha-N-acetylgalactosaminidase, stachyose synthase, and raffinose synthase. All GH36 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH36 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
pfam02065	Melibiase	1.02e-14	171	289	67	190	Melibiase. Glycoside hydrolase families GH27, GH31 and GH36 form the glycoside hydrolase clan GH-D. Glycoside hydrolase family 36 can be split into 11 families, GH36A to GH36K. This family includes enzymes from GH36A-B and GH36D-K and from GH27.
cd06592	GH31_NET37	3.13e-14	145	327	1	191	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd14792	GH27	9.33e-10	149	224	5	82	glycosyl hydrolase family 27 (GH27). GH27 enzymes occur in eukaryotes, prokaryotes, and archaea with a wide range of hydrolytic activities, including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-N-acetylgalactosaminidase, and 3-alpha-isomalto-dextranase. All GH27 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. GH27 members are retaining enzymes that cleave their substrates via an acid/base-catalyzed, double-displacement mechanism involving a covalent glycosyl-enzyme intermediate. Two aspartic acid residues have been identified as the catalytic nucleophile and the acid/base, respectively.
COG3345	GalA	1.06e-09	151	232	298	378	Alpha-galactosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ASI90717.1	5.46e-199	2	551	47	592
AYV23198.1	1.55e-198	2	551	47	592
AIQ22829.1	3.14e-147	2	553	36	576
AIQ68815.1	7.03e-145	14	548	63	587
QQZ59668.1	7.03e-145	9	548	59	587

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2YFN_A	3.07e-07	150	289	334	478	galactosidasedomain of alpha-galactosidase-sucrose kinase, AgaSK [[Ruminococcus] gnavus E1],2YFO_A GALACTOSIDASE DOMAIN OF ALPHA-GALACTOSIDASE-SUCROSE KINASE, AGASK, in complex with galactose [[Ruminococcus] gnavus E1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P43469	3.84e-09	95	289	278	472	Alpha-galactosidase 2 OS=Pediococcus pentosaceus OX=1255 GN=agaS PE=3 SV=1
P43467	5.11e-09	148	289	334	480	Alpha-galactosidase 1 OS=Pediococcus pentosaceus OX=1255 GN=agaR PE=3 SV=1
G4T4R7	1.84e-06	150	289	334	478	Bifunctional alpha-galactosidase/sucrose kinase AgaSK OS=Ruminococcus gnavus OX=33038 GN=agaSK PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000025	0.000045	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000338_00847.