CAZyme Information: MGYG000000338_01031

Basic Information

• Species: Anaerobiospirillum sp900543125
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Anaerobiospirillum; Anaerobiospirillum sp900543125
• CAZyme ID: MGYG000000338_01031
• CAZy Family: GH5
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
394		45536.78	5.417

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000338	3410865	MAG	Sweden	Europe

• Gene Location: Start: 1352; End: 2536 Strand: -

Full Sequence      

MSKSFLNGANLGNWLVLEKWMSPQLFRNSDADDEYYLPRTLERSDYESRIAQHRAEYISE
RDFVLLKGMGINSVRIPVPYFIFGDREPFIGCINELDNAMSWAEHYGISVLIDLHTAPMG
QNGFDNGGIQGVCKWSQTPEEVEFVLSVLERLAVRYGNHKALLGIQILNEPISERMWNLI
NLPKRYPARDPQLAAGSAPNTLDFLRDFYTEAYQRINMHLACDKKVVFHDAFELLAWQDF
MADKQKYPNVILDTHQYLMMVESNGCEQKLESYLDYLEHNLKAQYLEACKVHDVICGEWC
MFNSLACGYDTKGGQSVLNGVVSDSSNQGLPLAERTKIYQALCKAQMNIWKLGLGHYYWN
YKILFDTVNSKNWIGWDSWDLGRCHAFNWFKSDF

Enzyme Prediction     

EC	3.2.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	52	362	1.3e-129	0.9966887417218543

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG2730	BglC	9.99e-21	6	178	18	201	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].
pfam00150	Cellulase	1.36e-04	56	171	22	131	Cellulase (glycosyl hydrolase family 5).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRT49144.1	2.19e-187	6	392	3	387
QCU02863.1	6.85e-185	6	392	3	387
ANU75476.1	9.77e-184	5	393	2	388
QQQ93046.1	9.77e-184	5	393	2	388
ASU28285.1	9.77e-184	5	393	2	388

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6ZB9_A	3.01e-163	6	392	3	388	ChainA, Exo-beta-1,3-glucanase [uncultured bacterium],6ZB9_B Chain B, Exo-beta-1,3-glucanase [uncultured bacterium]
6ZB8_A	2.45e-162	6	392	3	388	ChainA, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium],6ZB8_B Chain B, Exo-beta-1,3-glucanase variant E167Q/E295Q [uncultured bacterium]
1H4P_A	2.13e-36	6	373	13	379	Crystalstructure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae],1H4P_B Crystal structure of exo-1,3-beta glucanse from Saccharomyces cerevisiae [Saccharomyces cerevisiae]
1EQP_A	4.36e-35	6	257	9	249	Exo-b-(1,3)-glucanaseFrom Candida Albicans [Candida albicans]
1CZ1_A	1.16e-34	6	257	9	249	Exo-b-(1,3)-glucanaseFrom Candida Albicans At 1.85 A Resolution [Candida albicans],1EQC_A Exo-b-(1,3)-glucanase From Candida Albicans In Complex With Castanospermine At 1.85 A [Candida albicans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5B5X8	1.10e-41	6	381	29	384	Probable glucan 1,3-beta-glucosidase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=exgA PE=3 SV=2
B8N151	1.13e-39	6	387	31	392	Probable glucan 1,3-beta-glucosidase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / IAM 13836 / NRRL 3357 / JCM 12722 / SRRC 167) OX=332952 GN=exgA PE=3 SV=1
Q7Z9L3	1.13e-39	6	387	31	392	Glucan 1,3-beta-glucosidase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) OX=510516 GN=exgA PE=1 SV=1
Q8NKF9	1.64e-39	6	373	37	399	Glucan 1,3-beta-glucosidase OS=Candida oleophila OX=45573 GN=EXG1 PE=3 SV=1
Q12626	7.27e-39	8	299	51	324	Glucan 1,3-beta-glucosidase OS=Pichia angusta OX=870730 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000075	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000338_01031.