CAZyme Information: MGYG000000338_01192

Basic Information

• Species: Anaerobiospirillum sp900543125
• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Enterobacterales; Succinivibrionaceae; Anaerobiospirillum; Anaerobiospirillum sp900543125
• CAZyme ID: MGYG000000338_01192
• CAZy Family: GH103
• CAZyme Description: Membrane-bound lytic murein transglycosylase B

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
354	MGYG000000338_64|CGC1	39018.4	7.882

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000338	3410865	MAG	Sweden	Europe

• Gene Location: Start: 4739; End: 5803 Strand: -

Full Sequence      

MRFSNSLSKTALSLGLSLSLACAAFSGNASAATGNEPDLNELARYASIDRALLDQAITQA
TYQQKIIDAMNRPYEGKPWHMYRKLFITDKRINGGVDFYLKHEQTLLAAQRELGVAPEVI
CAIIGVETFYGQNMGSWKVLDALYTLGFHYPKRSAYFSKEFANYVKLANREGWALTDTLG
SYAGAMGMGQFMPSSYLNFAIDFDSDGHVDLFSNPVDAIGSVANYFKEHGWILGAGVTYP
AHLKGVNGKPVSKATLDSLMKKEWKLTPKELTAAGITTKVALSADQNIRLYSFELADGSF
EYQVALNNFNTITRYNKSPLYARAVFELSEAIAMGYQEAKLLKGEYVSPSGKNP

Enzyme Prediction     

No EC number prediction in MGYG000000338_01192.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH103	39	332	1.1e-87	0.9694915254237289

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
TIGR02282	MltB	4.85e-112	39	332	4	290	lytic murein transglycosylase B. This family consists of lytic murein transglycosylases (murein hydrolases) in the family of MltB, which is a membrane-bound lipoprotein in Escherichia coli. The N-terminal lipoprotein modification motif is conserved in about half the members of this family. The term Slt35 describes a naturally occurring soluble fragment of MltB. Members of this family never contain the putative peptidoglycan binding domain described by pfam01471, which is associated with several classes of bacterial cell wall lytic enzymes. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]
pfam13406	SLT_2	1.23e-106	38	330	8	292	Transglycosylase SLT domain. This family is related to the SLT domain pfam01464.
PRK10760	PRK10760	8.41e-88	35	337	56	358	murein hydrolase B; Provisional
COG2951	MltB	3.80e-82	29	333	35	336	Membrane-bound lytic murein transglycosylase B [Cell wall/membrane/envelope biogenesis].
TIGR02283	MltB_2	1.33e-52	38	333	8	299	lytic murein transglycosylase. Members of this family are closely related to the MltB family lytic murein transglycosylases described by TIGR02282 and are likewise all proteobacterial, although that family and this one form clearly distinct clades. Several species have one member of each family. Many members of this family (unlike the MltB family) contain an additional C-terminal domain, a putative peptidoglycan binding domain (pfam01471), not included in region described by this model. Many sequences appear to contain N-terminal lipoprotein attachment sites, as does E. coli MltB in TIGR02282. [Cell envelope, Biosynthesis and degradation of murein sacculus and peptidoglycan]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AEY00981.1	1.05e-97	39	338	16	308
ACQ94423.1	3.21e-97	9	336	2	320
ATG74769.1	3.21e-97	39	339	29	322
QTL94749.1	1.01e-95	14	336	4	314
BCS50866.1	1.44e-95	14	336	4	314

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5O8X_A	1.40e-76	63	333	36	300	TheX-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa],5O8X_B The X-ray Structure of Catenated Lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa]
4ANR_A	2.35e-76	63	333	53	317	Crystalstructure of soluble lytic Transglycosylase SltB1 from Pseudomonas aeruginosa [Pseudomonas aeruginosa PAO1]
1LTM_A	3.26e-63	39	334	23	316	AcceleratedX-ray Structure Elucidation Of A 36 Kda Muramidase/transglycosylase Using Warp [Escherichia coli]
1D0K_A	3.45e-63	39	334	25	318	ChainA, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0L_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1D0M_A Chain A, 35KD SOLUBLE LYTIC TRANSGLYCOSYLASE [Escherichia coli],1QDR_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QDT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUS_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli],1QUT_A Chain A, LYTIC MUREIN TRANSGLYCOSYLASE B [Escherichia coli]
5ANZ_A	1.08e-24	48	335	64	346	CrystalStructure of SltB3 from Pseudomonas aeruginosa. [Pseudomonas aeruginosa],5AO7_A Crystal Structure of SltB3 from Pseudomonas aeruginosa in complex with NAG-anhNAM-pentapeptide [Pseudomonas aeruginosa]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P41052	5.59e-62	39	334	64	357	Membrane-bound lytic murein transglycosylase B OS=Escherichia coli (strain K12) OX=83333 GN=mltB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000429	0.525382	0.473531	0.000250	0.000220	0.000182

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000338_01192.