CAZyme Information: MGYG000000339_01639

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; Oscillospiraceae; UBA9475
• CAZyme ID: MGYG000000339_01639
• CAZy Family: GT39
• CAZyme Description: putative dolichyl-phosphate-mannose--protein mannosyltransferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
430		49503.25	7.8252

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000339	1808008	MAG	Sweden	Europe

• Gene Location: Start: 15; End: 1307 Strand: +

Full Sequence      

MDVGAEALFDEPEEWTTKQTYMNSSYFDEIYHPRTALEHLNNIYPYEVSHPPLGKLIMSI
GIALFGMVPFGWRFMGTLFGVLMLPILYVFLKNFFGKTPVAFCGTCLFAFDFMHLVQTRI
GTIDTYGVFFILVSYYFMYRWLCCPVGSSLRKTAVPLFLCGLFWGIGCACKWTVIYAGAG
LAVMWLLGLVFRYREWKLDPQGFDFISFVLSTTSLSIIFFVLLPSVIYTVSYIPYATAQG
NLTLDNLLNVMWSNQEFMLSYHQGVHSTHPYQSSWYQWIFDARPILYYRDLDLANTEGVK
SLFASFNNPLVSWAGLLAFFAVLIQTIRRKCGRGLFILIAILSQFLPWLPIGRTLFAYHY
FPTILFLVFAIAYLMNDMLDRHKKGATLAVYGFTGCTVAVYAIFYPALTGLYIPLWYSEV
FLRWFPSWPL

Enzyme Prediction     

No EC number prediction in MGYG000000339_01639.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT39	21	235	1.5e-49	0.9237668161434978

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1928	PMT1	3.53e-15	23	198	46	230	Dolichyl-phosphate-mannose--protein O-mannosyl transferase [Posttranslational modification, protein turnover, chaperones].
COG4346	COG4346	3.74e-11	46	391	132	425	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].
pfam16192	PMT_4TMC	1.01e-10	258	426	10	198	C-terminal four TMM region of protein-O-mannosyltransferase. PMT_4TMC is the C-terminal four membrane-pass region of protein-O-mannosyltransferases and similar enzymes.
pfam13231	PMT_2	3.81e-09	49	183	1	127	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	1.90e-08	23	198	19	203	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU42918.1	2.25e-166	1	429	222	652
QQR07704.1	2.25e-166	1	429	222	652
QIA32159.1	4.53e-165	1	429	218	648
ALP95330.1	5.29e-164	4	429	256	751
QBB67038.1	5.29e-164	4	429	256	751

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8NRZ6	1.64e-22	8	428	63	519	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / BCRC 11384 / JCM 1318 / LMG 3730 / NCIMB 10025) OX=196627 GN=pmt PE=3 SV=1
P9WN04	2.65e-19	27	428	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) OX=83331 GN=pmt PE=3 SV=2
P9WN05	2.65e-19	27	428	73	521	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=pmt PE=1 SV=2
L8F4Z2	6.45e-18	48	428	94	515	Probable dolichyl-phosphate-mannose--protein mannosyltransferase OS=Mycolicibacterium smegmatis (strain MKD8) OX=1214915 GN=pmt PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999863	0.000146	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
69	91
120	142
162	184
205	227
310	327
334	351
355	374
387	409