CAZyme Information: MGYG000000342_00038

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Oxalobacter
• CAZyme ID: MGYG000000342_00038
• CAZy Family: GT2
• CAZyme Description: Poly-beta-1,6-N-acetyl-D-glucosamine synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
322		37026.44	10.1579

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000342	990972	MAG	Sweden	Europe

• Gene Location: Start: 8216; End: 9184 Strand: -

Full Sequence      

MRVVQLATNQGKAVALKAGALAAKGEFLVCIDGDAILDHYAVTWIMSHFINNPRVGAVTG
NPRIRTRSTLLGRIQVGEFSAIVGLLKRAQRIYGRIFTISGVIGAYRRRALHSVGYWNEL
TLTEDIDISWRLQVKHWDIRFEPHALCWILMPETLGGLFKQRLRWAVGGGEAFKNYCHHL
FSWKARRFWGIFIEYILSVAWSYTLLLLTVISVIKLFIDLPDTPTEHILSLPYTGLILGA
TCLLQFAVCFFMERKYDRGLLSIYLAIIWYPLFYWILNWIVSIIAFPKAMFFSSGKKRGR
WHTTDRGINNRKEDDVLTRPND

Enzyme Prediction     

EC	2.4.1.-

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	29	275	8.5e-23	0.949238578680203

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11204	PRK11204	4.92e-161	2	310	112	420	N-glycosyltransferase; Provisional
TIGR03937	PgaC_IcaA	1.67e-150	2	307	103	407	poly-beta-1,6 N-acetyl-D-glucosamine synthase. Members of this protein family are biofilm-forming enzymes that polymerize N-acetyl-D-glucosamine residues in beta(1,6) linkage. One named members is IcaA (intercellular adhesin protein A), an enzyme that acts (with aid of subunit IcaD) in Polysaccharide Intercellular Adhesin (PIA) biosynthesis in Staphylococcus epidermis). The homologous member in E. coli is designated PgaC. Members are often encoded next to a polysaccharide deacetylase and involved in biofilm formation. Note that chitin, although also made from N-acetylglucosamine, is formed with beta-1,4 linkages.
PRK14583	hmsR	4.32e-128	1	308	132	439	poly-beta-1,6 N-acetyl-D-glucosamine synthase.
COG1215	BcsA	4.75e-38	3	298	116	424	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	4.08e-29	26	125	80	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDX34178.1	2.27e-189	1	322	101	418
ARQ78210.1	2.91e-189	1	322	108	425
ARQ46009.1	2.91e-189	1	322	108	425
ABA90025.1	9.94e-131	1	308	111	417
APG43061.1	1.07e-127	1	308	111	417

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P75905	8.16e-108	1	308	132	438	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli (strain K12) OX=83333 GN=pgaC PE=1 SV=1
Q8XAR5	1.15e-107	1	308	132	438	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Escherichia coli O157:H7 OX=83334 GN=pgaC PE=3 SV=1
Q5HKQ0	2.23e-68	4	307	106	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) OX=176279 GN=icaA PE=1 SV=1
Q8GLC5	3.14e-68	4	307	106	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus epidermidis OX=1282 GN=icaA PE=3 SV=1
Q8NUI7	3.00e-65	4	307	106	408	Poly-beta-1,6-N-acetyl-D-glucosamine synthase OS=Staphylococcus aureus (strain MW2) OX=196620 GN=icaA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000062	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
192	214
229	251
264	286