CAZyme Information: MGYG000000342_00983

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; Oxalobacter
• CAZyme ID: MGYG000000342_00983
• CAZy Family: GH13
• CAZyme Description: 1,4-alpha-glucan branching enzyme GlgB

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
316		36529.43	6.2799

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000342	990972	MAG	Sweden	Europe

• Gene Location: Start: 72; End: 1022 Strand: +

Full Sequence      

MLYRDYSRAPGEWIPNKYGGRENLEAIAFLRRLNETVGIERPEAVTMAEESTSFPGVTHP
VWDGGLGFHYKWNMGWMHDTLSYMGEDPVYRKYHHDKMRFGLMYAYSENFILPLSHDEVV
HCKGSLIGKMSGDDWQRFANLRAYFGFMWGYPGKKLLFMGGEFAQYREWNANGSLDWDLL
RYPPHAGVQRLVRDLNTIYRDFPALSRLDYDPAGFEWIIHDDVDESVFSFMRRDGDRQFV
VVISNFTPVPRYGYRIGVPEPGWYREIINTDAVIYGGSGIHNHELLAQPVPSNGMPWSIV
VTASPLATCMLIRKND

Enzyme Prediction     

EC	2.4.1.18

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH13	1	165	7.1e-84	0.5448504983388704

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK05402	PRK05402	0.0	1	311	409	721	1,4-alpha-glucan branching protein GlgB.
PRK12313	PRK12313	2.56e-178	1	308	314	622	1,4-alpha-glucan branching protein GlgB.
TIGR01515	branching_enzym	4.75e-154	1	311	305	617	alpha-1,4-glucan:alpha-1,4-glucan 6-glycosyltransferase. This model describes the glycogen branching enzymes which are responsible for the transfer of chains of approx. 7 alpha(1--4)-linked glucosyl residues to other similar chains (in new alpha(1--6) linkages) in the biosynthesis of glycogen. This enzyme is a member of the broader amylase family of starch hydrolases which fold as (beta/alpha)8 barrels, the so-called TIM-barrel structure. All of the sequences comprising the seed of this model have been experimentally characterized. This model encompasses both bacterial and eukaryotic species. No archaea have this enzyme, although Aquifex aolicus does. Two species, Bacillus thuringiensis and Clostridium perfringens have two sequences each which are annotated as amylases. These annotations are aparrently in error. GP|18143720 from C. perfringens, for instance, contains the note "674 aa, similar to gp:A14658_1 amylase (1,4-alpha-glucan branching enzyme (EC 2.4.1.18) ) from Bacillus thuringiensis (648 aa); 51.1% identity in 632 aa overlap." A branching enzyme from Porphyromonas gingivales, OMNI|PG1793, appears to be more closely related to the eukaryotic species (across a deep phylogenetic split) and may represent an instance of lateral transfer from this species' host. A sequence from Arabidopsis thaliana, GP|9294564, scores just above trusted, but appears either to contain corrupt sequence or, more likely, to be a pseudogene as some of the conserved catalytic residues common to the alpha amylase family are not conserved here. [Energy metabolism, Biosynthesis and degradation of polysaccharides]
PRK12568	PRK12568	2.81e-147	1	311	413	726	glycogen branching enzyme; Provisional
COG0296	GlgB	8.66e-138	1	311	308	626	1,4-alpha-glucan branching enzyme [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARQ45443.1	1.25e-206	1	316	410	725
ARQ77719.1	1.25e-206	1	316	410	725
AVQ82436.1	1.12e-160	1	312	411	722
QRY33294.1	1.12e-160	1	312	411	722
QJE03417.1	6.28e-160	1	315	398	712

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4LPC_A	1.26e-137	1	316	294	612	CrystalStructure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_B Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_C Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LPC_D Crystal Structure of E.Coli Branching Enzyme in complex with maltoheptaose [Escherichia coli],4LQ1_A Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_B Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_C Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],4LQ1_D Crystal Structure of E.Coli Branching Enzyme in complex with maltohexaose [Escherichia coli],5E6Y_A Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_B Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_C Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Y_D Crystal structure of E.Coli branching enzyme in complex with alpha cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_A Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_B Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_C Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E6Z_D Crystal structure of Ecoli Branching Enzyme with beta cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_A Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_B Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_C Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A],5E70_D Crystal structure of Ecoli Branching Enzyme with gamma cyclodextrin [Escherichia coli O139:H28 str. E24377A]
1M7X_A	1.46e-137	1	316	299	617	TheX-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_B The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_C The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli],1M7X_D The X-ray Crystallographic Structure of Branching Enzyme [Escherichia coli]
6JOY_A	9.14e-126	1	311	310	616	TheX-ray Crystallographic Structure of Branching Enzyme from Rhodothermus obamensis STB05 [Rhodothermus marinus]
5GQW_A	6.70e-105	1	316	459	774	Crystalstructure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 [Crocosphaera subtropica ATCC 51142],5GQX_A Crystal structure of branching enzyme W610N mutant from Cyanothece sp. ATCC 51142 in complex with maltoheptaose [Crocosphaera subtropica ATCC 51142]
6KLF_A	8.67e-104	1	316	435	750	ChainA, 1,4-alpha-glucan branching enzyme GlgB [Crocosphaera subtropica ATCC 51142]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A1JSJ0	2.55e-144	1	313	410	725	1,4-alpha-glucan branching enzyme GlgB OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) OX=393305 GN=glgB PE=3 SV=1
A7FNX5	2.88e-143	1	315	410	727	1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) OX=349747 GN=glgB PE=3 SV=1
Q1C1D9	2.88e-143	1	315	410	727	1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pestis bv. Antiqua (strain Antiqua) OX=360102 GN=glgB PE=3 SV=1
Q664I2	2.88e-143	1	315	410	727	1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) OX=273123 GN=glgB PE=3 SV=1
Q1CDL3	2.88e-143	1	315	410	727	1,4-alpha-glucan branching enzyme GlgB OS=Yersinia pestis bv. Antiqua (strain Nepal516) OX=377628 GN=glgB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000059	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000342_00983.