CAZyme Information: MGYG000000343_00073

Basic Information

• Species: Odoribacter sp900548135
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900548135
• CAZyme ID: MGYG000000343_00073
• CAZy Family: CBM32
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
952	MGYG000000343_1|CGC2	106980.99	4.9139

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000343	3841231	MAG	Sweden	Europe

• Gene Location: Start: 83863; End: 86721 Strand: +

Full Sequence      

MIRYIGRWGNENGVVDMSELNLWFIDMKLLIFFFMNLLLTLSSCSEDSAESIPVLQVGAD
TVVLKNTIDGQNVTVVSSADWEAVVEEECDWCRCIVNKGMTSFVRIETDANNQVEERWTF
VTLISGSLKHTIRVCQFGAAPAIITLPAAFDNLSFEPVEFVLQTIANVEVEVMLPDTVAW
VNKNREEVGDTVRSYFKTNLNSSVLPRETWITVSHKGGTLVRRVRVWQAGRNGDYEIQSP
EEVVRDAKLVIDGSRSGASSVQAGSGDFAKSFDGDMGTLYHSNWSNEGEHYFPITLEYAF
ATDESELDYLIYYPRTDGPNGRFKQVEISYKKRGDDSYTVLGEVDFGGSASPRKVDFPDG
VRNPDKVKFVIKSGAGNGQGFASCAEMEFYRKVVPDVSLTAVFTDETYSALRENVTYEQI
QGLENAFYREIAKALFLGIYPLADRVREYEAYADPDWIARRYKINSYNRLDNATGIYVRA
GDELVIFCGNTAGQQLGLWVMDWAKGYSGKSYMLIEGVNRINMSSSGLVYVSYYASDPAA
APKVKLHFATGQVNGCFRLGENKDTDWSGLLNKSVGGYLDMQGKYTHMCWPVSKLRSIVT
QPTELLEVYDRMVRLEHELMGLYKYDIPIKNRMFFHAVATDDYMYATSYRTAYHENTLSE
ILNVNKMKSGVAVWGPAHEVGHMHQTRPGLKWIGMTEVTNNIHSLNVETTFGHRSRLMRE
KMGEAEGGGTRYEKAFTNIIARGIAHNEEGDVFCKLVPFWQLQLYAGKIAGKPDLYPELH
ESVRNMTDPTGDTKNGVCQLNFVEQCCRVLDEDLTVFFEAWGFLKEMDKVVTDYATERMW
VTADGIASVKAKIAGYTDMKLKGLIYLNDENVGLFQNSQAVVPGKVAHNNREVTLSGWEN
VVAYELCEGDRIIMIAQRETFKVPETYGEIDWAATSIRGVAADGTRVSVAFE

Enzyme Prediction     

No EC number prediction in MGYG000000343_00073.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13402	Peptidase_M60	3.51e-49	557	822	8	268	Peptidase M60, enhancin and enhancin-like. This family of peptidases contains a zinc metallopeptidase motif (HEXXHX(8,28)E) and possesses mucinase activity. It includes the viral enhancins as well as enhancin-like peptidases from bacterial species. Enhancins are a class of metalloproteases found in some baculoviruses that enhance viral infection by degrading the peritrophic membrane (PM) of the insect midgut. Bacterial enhancins are found to be cytotoxic when compared to viral enhancin, however, suggesting that the bacterial enhancins do not enhance infection in the same way as viral enhancin. Bacterial enhancins may have evolved a distinct biochemical function. These bacterial domains are peptidases targetting host glycoproteins and thus probably play an important role in successful colonisation of both vertebrate mucosal surfaces and the invertebrate digestive tract by both mutualistic and pathogenic microbes. This family has been augmented by a merge with the sequences in the Enhancin Pfam family.
pfam00754	F5_F8_type_C	4.15e-09	258	387	4	127	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd14948	BACON	5.18e-08	55	136	2	82	Bacteroidetes-Associated Carbohydrate-binding (putative) Often N-terminal (BACON) domain. The BACON domain is found in diverse domain architectures and accociated with a wide variety of domains, including carbohydrate-active enzymes and proteases. It was named for its suggested function of carbohydrate binding; the latter was inferred from domain architectures, sequence conservation, and phyletic distribution. However, recent experimental data suggest that its primary function in Bacteroides ovatus endo-xyloglucanase BoGH5A is to distance the catalytic module from the cell surface and confer additional mobility to the catalytic domain for attack of the polysaccharide. No evidence for a direct role in carbohydrate binding could be found in that case. The large majority of BACON domains are found in Bacteroidetes.
pfam17291	M60-like_N	5.51e-04	459	547	7	107	N-terminal domain of M60-like peptidases. This accessory domain has a jelly roll topology.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCT79445.1	9.26e-202	37	951	16	939
QRP89238.1	9.26e-202	37	951	16	939
QUU03487.1	1.84e-201	37	951	16	939
QRM71921.1	1.55e-196	35	951	14	939
QTO25368.1	4.33e-196	35	951	14	939

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SCI_A	1.03e-70	402	855	14	472	ChainA, Peptidase M60 domain-containing protein [Akkermansia muciniphila ATCC BAA-835]
5KD2_A	5.73e-55	396	947	28	605	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5KD5_A	6.20e-48	445	947	31	557	BT_4244metallopeptidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5KD8_A BT_4244 metallopeptidase in complex with Tn antigen. [Bacteroides thetaiotaomicron VPI-5482]
5EV7_A	1.18e-44	474	844	46	407	Thecrystal structure of a functionally unknown conserved protein mutant from Bacillus anthracis str. Ames [Bacillus anthracis str. Ames]
4FCA_A	4.31e-43	474	844	46	407	Thecrystal structure of a functionally unknown conserved protein from Bacillus anthracis str. Ames. [Bacillus anthracis str. Ames]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.008657	0.517254	0.473292	0.000194	0.000323	0.000261

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000343_00073.