CAZyme Information: MGYG000000343_00183

Basic Information

• Species: Odoribacter sp900548135
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900548135
• CAZyme ID: MGYG000000343_00183
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
860	MGYG000000343_1|CGC4	95221.22	7.4814

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000343	3841231	MAG	Sweden	Europe

• Gene Location: Start: 220180; End: 222762 Strand: +

Full Sequence      

MKKTYLWIGMLWLLAGCSGLSDKMAYKDASLPIGQRVEDLLERMTLDEKVAQLRHLHAYA
ISDGNRLDTAKLRKMTADRSMGCVEGITLSGKECARFMLEIQQYMMKQTRLGIPVFPLTE
SLHGSVHEGSTIFPQAIALGSTFNPDLAYRMTVAIAEELQVQGIRQSLTPVLDVVRDLRW
GRVEECFGEDPYLVSRMGVNEVRGYLDQGVSPMLKHFGAHACPAGGLNLASVACGQRDLL
SVYLQPFETVVRETKPWAVMSSYNSWNQEPNSSSAYLMTDLLRKQWKFQGYVYSDWGAIG
MLNYFHKTAQNGADAARQALMAGLDVEASDNCYANLVDLVKAGELEVRHIDEAVRRVLRA
KFAMGLFDRPYPDTSRYDEVVHCPEHVALARKIAEESVVLLKNEGKILPLEAGRLKSVAV
IGPNAAQVQFGDYTWSRSNRDGVTLLQALQEQYGKTLQINYAPGCDLVTMDKSGFGEAVA
ASRKSDVSIVVVGTASASLARDYSNATCGEGFDLSDLTLTGVQEELIKAVYATGKPVIVV
LLSGKPFAMPWVKQHIPGILIQWYPGEQGGYALADILFGKVNPSGKLNYSFPKSVGHLPC
FYNYLPTDKGFYKRPGALGKPGKDYVFSSPDALWAFGHGLSYTEFDYLSLETDKEDYRQE
DTIRTIVTLRNTGNCDGREVVQLYVRDVVSSVVTPVHELKGFSKVSVPQGEKVAVEIKVP
VSSLCLYNQKMQRVVEPGAFELQIGSASDDIRIKKLITVERDKEKKVIINRQEKGHKTAV
GRLAVPVDVHGIVRDVQANPLAGITVEVGKKKAVTDIHGQYQLKAMSTDTIRVQGQNYRP
EIIALEGRQVIHVTLVRNNE

Enzyme Prediction     

No EC number prediction in MGYG000000343_00183.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	107	327	1.1e-65	0.9768518518518519

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK15098	PRK15098	2.45e-177	1	752	1	758	beta-glucosidase BglX.
PLN03080	PLN03080	1.67e-96	28	745	44	769	Probable beta-xylosidase; Provisional
COG1472	BglX	2.24e-92	44	467	1	397	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	8.72e-77	45	360	1	316	Glycosyl hydrolase family 3 N terminal domain.
pfam01915	Glyco_hydro_3_C	1.44e-69	398	642	1	216	Glycosyl hydrolase family 3 C-terminal domain. This domain is involved in catalysis and may be involved in binding beta-glucan. This domain is found associated with pfam00933.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU03453.1	0.0	26	856	26	857
CBW23395.1	0.0	26	856	26	857
QCQ42496.1	0.0	26	856	26	857
BAD49810.1	0.0	26	856	26	857
AKA52531.1	0.0	26	856	26	857

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5YOT_A	1.02e-170	22	752	3	749	Isoprimeverose-producingenzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YOT_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_A Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40],5YQS_B Isoprimeverose-producing enzyme from Aspergillus oryzae in complex with isoprimeverose [Aspergillus oryzae RIB40]
7EAP_A	8.02e-170	22	752	3	749	ChainA, Fn3_like domain-containing protein [Aspergillus oryzae RIB40]
5Z87_A	6.41e-137	14	752	26	778	ChainA, EmGH1 [Aurantiacibacter marinus],5Z87_B Chain B, EmGH1 [Aurantiacibacter marinus]
6R5I_A	1.16e-116	37	745	7	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5I_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5N_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]
6R5O_A	6.26e-116	37	745	7	719	ChainA, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5O_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5R_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5T_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5U_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_A Chain A, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1],6R5V_B Chain B, Periplasmic beta-glucosidase [Pseudomonas aeruginosa PAO1]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
T2KMH0	1.87e-135	100	752	52	716	Beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22130 PE=1 SV=1
T2KMH9	3.98e-128	26	752	29	748	Putative beta-xylosidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22230 PE=2 SV=1
P33363	1.04e-121	37	755	38	759	Periplasmic beta-glucosidase OS=Escherichia coli (strain K12) OX=83333 GN=bglX PE=3 SV=2
Q56078	1.10e-120	37	754	38	758	Periplasmic beta-glucosidase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bglX PE=3 SV=2
P14002	4.09e-98	110	759	34	668	Thermostable beta-glucosidase B OS=Acetivibrio thermocellus (strain ATCC 27405 / DSM 1237 / JCM 9322 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) OX=203119 GN=bglB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000000	1.000056	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000343_00183.