CAZyme Information: MGYG000000343_00202

Basic Information

• Species: Odoribacter sp900548135
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900548135
• CAZyme ID: MGYG000000343_00202
• CAZy Family: GH35
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
908		103386.82	6.715

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000343	3841231	MAG	Sweden	Europe

• Gene Location: Start: 258995; End: 261721 Strand: +

Full Sequence      

MGEVLAQQLPEKYFYHPERIRYDGDCFTIEGEDIFILSAAFHYFRVPQELWRDRFRKIQE
AGFNTVETYVPWNWHERNMPKGLKDFSQCNFDDLRAWLKMAHEEFGLYTIVRPGPFICAE
WAGGAHPRWLGKFCPEKYETSFWLRSNHPDYLKWIGHWYDAVSPVFAEEQLCRKEPGEKG
IIMVQLENEYVYFGMEGEKKIEVLKCLAGHCLKNGIEVPLFTCVTPEVRGSQDPLISQLF
DMDNQYVWWNIHEAKMRLEDLKRQQPNAPAFVCELQGGWFSTVGGGLSEDYHLDGRHARG
MALMGIAGGGTGLNYYMFFGGTHLAGWGARRMTTTYDYGAPLKESGGVGEKYAAVKGIGE
FVGKYGKQLVRSKAVEFKTVVNPEKLTVAVRRATDGTWFLFFHNCDRKLPFRENVVLKTV
TGEVFHAYCSLDPSDSRVLVVKNDKSQGVWWPKEQALPQRPTNMPEPIRIARVETRPEIY
NAKWKKLSNGRSLPELGVNDCRYSMYRSTVKLTSQEADRFGSLVCEMFTGDPLYLEVNGK
VAERASSDELDNTFVLDGLLQPGMNQFTAIYENQGHAHGYRPMEELSGMKSAGLGKKQTA
ILPVEDWDVKEIIGKDYDVRQLLASQEGWEKIRLNQKTIADLATLQIAGLQKPEWPAAWV
LQNKTGKAVYRTTLEYTPGMITDERTLLEFGCVDDEGTLWVNGKEVATHNSWETPFRVNL
ARYIRSGKNEIAIVVTNNSGNGGLLKGVRLLRDLKVVKPLKWEVALDLGGVENGYCLPGL
SQEGWQNISLDTTKSLKRKGNNIQPRGERNGLLTWYRVTFDLPVATPDVWIPWRAIINAS
GNGYIWLNGHNIGRHWEAGPQREFYLPECWLNFGGKNTLVLGLRQSEQCGALLEGVEILP
YYEDAEMR

Enzyme Prediction     

No EC number prediction in MGYG000000343_00202.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH35	27	358	1.5e-90	0.9869706840390879

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01301	Glyco_hydro_35	4.07e-72	27	356	2	312	Glycosyl hydrolases family 35.
PLN03059	PLN03059	5.59e-31	20	346	30	325	beta-galactosidase; Provisional
COG1874	GanA	4.03e-23	20	190	1	161	Beta-galactosidase GanA [Carbohydrate transport and metabolism].
pfam02837	Glyco_hydro_2_N	4.36e-08	624	739	19	137	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.
pfam02449	Glyco_hydro_42	3.50e-07	44	190	5	138	Beta-galactosidase. This group of beta-galactosidase enzymes belong to the glycosyl hydrolase 42 family. The enzyme catalyzes the hydrolysis of terminal, non-reducing terminal beta-D-galactosidase residues.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUU07680.1	0.0	4	908	17	921
QRP57068.1	0.0	4	906	17	920
ASM65763.1	0.0	4	906	17	920
QQT77688.1	0.0	4	906	17	920
QCQ49125.1	0.0	2	906	20	924

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3THC_A	5.43e-41	20	358	11	330	Crystalstructure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_B Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_C Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THC_D Crystal structure of human beta-galactosidase in complex with galactose [Homo sapiens],3THD_A Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_B Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_C Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens],3THD_D Crystal structure of human beta-galactosidase in complex with 1-deoxygalactonojirimycin [Homo sapiens]
3WEZ_A	6.86e-41	20	358	35	354	Crystalstructure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_B Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_C Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WEZ_D Crystal structure of human beta-galactosidase in complex with NOEV [Homo sapiens],3WF0_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF0_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-DGJ [Homo sapiens],3WF1_A Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_B Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_C Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF1_D Crystal structure of human beta-galactosidase in complex with 6S-NBI-GJ [Homo sapiens],3WF2_A Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_B Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_C Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens],3WF2_D Crystal structure of human beta-galactosidase in complex with NBT-DGJ [Homo sapiens]
3WF3_A	1.64e-40	20	358	35	354	Crystalstructure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_B Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_C Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF3_D Crystal structure of human beta-galactosidase mutant I51T in complex with Galactose [Homo sapiens],3WF4_A Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_B Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_C Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens],3WF4_D Crystal structure of human beta-galactosidase mutant I51T in complex with 6S-NBI-DGJ [Homo sapiens]
4MAD_A	1.82e-39	19	360	17	337	ChainA, Beta-galactosidase [Niallia circulans],4MAD_B Chain B, Beta-galactosidase [Niallia circulans]
7KDV_A	8.35e-38	19	356	17	335	ChainA, Beta-galactosidase [Mus musculus],7KDV_C Chain C, Beta-galactosidase [Mus musculus],7KDV_E Chain E, Beta-galactosidase [Mus musculus],7KDV_G Chain G, Beta-galactosidase [Mus musculus],7KDV_I Chain I, Beta-galactosidase [Mus musculus],7KDV_K Chain K, Beta-galactosidase [Mus musculus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q5R7P4	8.03e-43	20	358	34	353	Beta-galactosidase OS=Pongo abelii OX=9601 GN=GLB1 PE=2 SV=1
P16278	3.72e-40	20	358	34	353	Beta-galactosidase OS=Homo sapiens OX=9606 GN=GLB1 PE=1 SV=2
Q60HF6	6.97e-40	20	358	34	353	Beta-galactosidase OS=Macaca fascicularis OX=9541 GN=GLB1 PE=2 SV=1
Q9TRY9	1.47e-39	20	367	35	360	Beta-galactosidase OS=Canis lupus familiaris OX=9615 GN=GLB1 PE=1 SV=3
O19015	2.02e-38	19	358	34	354	Beta-galactosidase OS=Felis catus OX=9685 GN=GLB1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000343_00202.