CAZyme Information: MGYG000000343_00204

Basic Information

• Species: Odoribacter sp900548135
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900548135
• CAZyme ID: MGYG000000343_00204
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
362		42061.26	9.3486

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000343	3841231	MAG	Sweden	Europe

• Gene Location: Start: 263413; End: 264501 Strand: +

Full Sequence      

MRRRYSFCLQIGLFLMLFMDLAVMSKAQPGITEPYSGIKPSKFQRGQIKRQYGMFIHFGI
NTFHNTEWSDGTLPASSYVPPVIDARQWVETAKKAGMKYVILVAKHHDGFCLWDSRYTSY
DVAASGNTTNVIEAVARECRRQGIRLGLYYSLWDRKENADVNNQEADAAYNEYMLGQLNE
LMDITSKYTRVVEFWFDGSWTKPACRWPIVEIYKTIKQREPQCQIGINWSIGQDPDPLDP
QSPRKSVNIKPADQKEGDPIRYFPSDFRLGDPELPVVPDPKIFTHKGKKYYMPFEATVCM
SRRWFYHTNDTTYKSMDELVKLYKRATAQDNILILNVPPTRDGRMRTKDVEILVELRKRV
GK

Enzyme Prediction     

No EC number prediction in MGYG000000343_00204.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	50	357	2.3e-69	0.8265895953757225

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	2.29e-44	53	356	28	324	Alpha-L-fucosidase.
smart00812	Alpha_L_fucos	7.14e-43	53	356	29	326	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
COG3669	AfuC	2.56e-37	37	356	8	308	Alpha-L-fucosidase [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ATP59154.1	5.16e-164	13	362	6	349
QOD59462.1	9.89e-161	34	362	26	347
QRO24265.1	6.11e-160	21	361	11	348
QTO26593.1	3.91e-159	17	361	10	346
QCQ30777.1	3.91e-159	17	361	10	346

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4ZRX_A	3.74e-40	40	355	32	347	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
3EYP_A	3.94e-37	37	349	7	308	Crystalstructure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],3EYP_B Crystal structure of putative alpha-L-fucosidase from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron],4OUE_A Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OUE_B Crystal structure of an a-L-Fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with IPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_A Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482],4OZO_B Crystal structure of an a-L-fucosidase GH29 from Bacteroides thetaiotaomicron (BT2192) in complex with oNPTG [Bacteroides thetaiotaomicron VPI-5482]
5K9H_A	5.96e-37	28	361	28	353	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
3UES_A	1.14e-35	27	361	5	348	Crystalstructure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088],3UES_B Crystal structure of alpha-1,3/4-fucosidase from Bifidobacterium longum subsp. infantis complexed with deoxyfuconojirimycin [Bifidobacterium longum subsp. infantis ATCC 15697 = JCM 1222 = DSM 20088]
6ORG_A	1.06e-34	37	355	8	314	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7XUR3	1.16e-37	40	355	40	336	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
Q8GW72	3.69e-37	47	355	42	335	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
P10901	4.50e-13	51	211	41	236	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
P17164	1.10e-11	12	234	14	264	Tissue alpha-L-fucosidase OS=Rattus norvegicus OX=10116 GN=Fuca1 PE=1 SV=1
Q9VTJ4	1.56e-11	53	207	56	238	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000196	0.999260	0.000141	0.000142	0.000122	0.000119

TMHMM  Annotations     

start	end
7	24