CAZyme Information: MGYG000000343_00884

Basic Information

• Species: Odoribacter sp900548135
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900548135
• CAZyme ID: MGYG000000343_00884
• CAZy Family: CE4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
333		38663.72	7.9007

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000343	3841231	MAG	Sweden	Europe

• Gene Location: Start: 52466; End: 53467 Strand: +

Full Sequence      

MRNARLKHRLIKFGIAGLLRAVNKNPRVIFWHGVELVDENPSLHISPEMFEEELHFLNRY
YEIIPIEEYEARFRRYKFTGREVVLTFDDGYKNNLTIAAPILKKLNLPFTVFISTAHMDS
QRFFPTAIVRMIVLDSCLTELHLDSIGLDVVLQDAKQRRQICDSIIFTIKHSSVTLVNRI
CKELAASVTAEEFRRLSELHRADRPMTWDEVKQLHTGYACTVGSHCADHFICNNWQSEQE
VERQLVESKQLIEEKLNVSCDYLAYPNGVYPAGDVTVYARKMAEKAGYKLAFTTVTDRLR
ADTDPYLMPRCAARFEKEDFIMKLVLKPKLAWK

Enzyme Prediction     

No EC number prediction in MGYG000000343_00884.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE4	79	294	8e-26	0.9307692307692308

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10918	CE4_NodB_like_5s_6s	1.39e-39	83	310	2	151	Putative catalytic NodB homology domain of PgaB, IcaB, and similar proteins which consist of a deformed (beta/alpha)8 barrel fold with 5- or 6-strands. This family belongs to the large and functionally diverse carbohydrate esterase 4 (CE4) superfamily, whose members show strong sequence similarity with some variability due to their distinct carbohydrate substrates. It includes bacterial poly-beta-1,6-N-acetyl-D-glucosamine N-deacetylase PgaB, hemin storage system HmsF protein in gram-negative species, intercellular adhesion proteins IcaB, and many uncharacterized prokaryotic polysaccharide deacetylases. It also includes a putative polysaccharide deacetylase YxkH encoded by the Bacillus subtilis yxkH gene, which is one of six polysaccharide deacetylase gene homologs present in the Bacillus subtilis genome. Sequence comparison shows all family members contain a conserved domain similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, which consists of a deformed (beta/alpha)8 barrel fold with 6 or 7 strands. However, in this family, most proteins have 5 strands and some have 6 strands. Moreover, long insertions are found in many family members, whose function remains unknown.
cd10969	CE4_Ecf1_like_5s	9.63e-34	47	314	1	203	Putative catalytic NodB homology domain of a hypothetical protein Ecf1 from Escherichia coli and similar proteins. This family contains a hypothetical protein Ecf1 from Escherichia coli and its prokaryotic homologs. Although their biochemical properties remain to be determined, members in this family contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10968	CE4_Mlr8448_like_5s	5.42e-25	81	310	1	155	Putative catalytic NodB homology domain of Mesorhizobium loti Mlr8448 protein and its bacterial homologs. This family contains Mesorhizobium loti Mlr8448 protein and its bacterial homologs. Although their biochemical properties are yet to be determined, members in this subfamily contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10973	CE4_DAC_u4_5s	8.35e-22	83	310	3	150	Putative catalytic NodB homology domain of uncharacterized bacterial polysaccharide deacetylases which consist of a 5-stranded beta/alpha barrel. This family contains many uncharacterized bacterial polysaccharide deacetylases. Although their biological functions remain unknown, all members of the family are predicted to contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.
cd10971	CE4_DAC_u2_5s	3.73e-14	83	310	2	191	Putative catalytic NodB homology domain of uncharacterized prokaryotic polysaccharide deacetylases which consist of a 5-stranded beta/alpha barrel. This family contains many uncharacterized prokaryotic polysaccharide deacetylases. Although their biological functions remain unknown, all members of this family are predicted to contain a conserved domain with a 5-stranded beta/alpha barrel, which is similar to the catalytic NodB homology domain of rhizobial NodB-like proteins, belonging to the larger carbohydrate esterase 4 (CE4) superfamily.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARN74521.1	8.51e-15	7	300	411	697
SHJ21488.1	1.20e-13	40	310	429	695
QAU35404.1	2.19e-13	48	310	59	310
AEG61805.1	3.41e-12	42	324	61	271
QJD99891.1	9.76e-12	14	310	21	309

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000343_00884.