CAZyme Information: MGYG000000343_00885

Basic Information

• Species: Odoribacter sp900548135
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900548135
• CAZyme ID: MGYG000000343_00885
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368		42959.56	9.4432

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000343	3841231	MAG	Sweden	Europe

• Gene Location: Start: 53458; End: 54564 Strand: +

Full Sequence      

MEIKHILVIRFRRVGDSVLATALCRSLRQSFPQAQIDYVLNENIAVLYENHPDIDRVITF
SDRENHHLPTYIRKVRHIMKSTSYDIIIDMRTTVRTLLFSLFSLHTPFRIGHFKKYSWGL
HNYRIKNKAGHLLGIVQQNQLLLKPLEKLTTLYYADEFTLYVDEGQCRKFREYMVREGID
FNRPVILAAVTSREAYKVWPLDRMEEILRRIINQFDAQIIFNYAGSEKDFAIALHRRMGM
HSNIFTCIEAKSLTELCALTRNCDFFFGNEGGPRHISQALSVPSFAIFAPGNATSNWLPG
DRSRYHGIGPEEIRPLQAGENLRDPERFKLITVERVWDELFPMLEKYFYGKKRIEKSEVI
SSSGKISF

Enzyme Prediction     

No EC number prediction in MGYG000000343_00885.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	74	300	2.6e-31	0.8488888888888889

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03789	GT9_LPS_heptosyltransferase	8.10e-47	5	340	1	275	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	1.06e-44	3	340	1	326	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
pfam01075	Glyco_transf_9	2.18e-19	72	290	1	211	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BAR51520.1	1.25e-125	1	347	5	350
BAR48400.1	1.25e-125	1	347	5	350
AEW22458.1	1.25e-125	1	347	5	350
QRO51368.1	6.38e-116	1	354	1	354
AVV52897.1	7.05e-116	7	347	13	352

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3TOV_A	1.88e-12	1	292	6	291	Thecrystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008],3TOV_B The crystal structure of the glycosyl transferase family 9 from Veillonella parvula DSM 2008 [Veillonella parvula DSM 2008]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P25742	5.53e-12	15	330	5	308	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli (strain K12) OX=83333 GN=rfaQ PE=3 SV=2
Q9R9D5	6.08e-09	15	288	5	276	Lipopolysaccharide core heptosyltransferase RfaQ OS=Escherichia coli OX=562 GN=rfaQ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000061	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000343_00885.