CAZyme Information: MGYG000000343_02619

Basic Information

• Species: Odoribacter sp900548135
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900548135
• CAZyme ID: MGYG000000343_02619
• CAZy Family: GT4
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
361		41081.95	9.1403

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000343	3841231	MAG	Sweden	Europe

• Gene Location: Start: 43435; End: 44520 Strand: +

Full Sequence      

MKLVVTGTRGVPNIMGGVETHCEELFPRIVRKGFDVYLIRRKKYVRDSLKEYKGIQLIDI
AAPKKKAFEAIVHTFLAVWKAKRLHADLIHIHAIGPALLVPLARFLGLKVVFTHHGPDYE
RAKWGWLAKSFLKLGERLGCRYAHEVIVISQVIQKRVADQYGRQDTHLIRNGIPLPDFVE
DTTYLEELGIEDGNYILSVGRFVPEKNYHRLIRCFASASSGTCRLVLAGDANINDRYSTD
LKQMALKYKVVLTGFIQGKKLHSLLTHARCFILPSSHEGLPIALLEAMTYRLPVIVSNIP
ANAEIGLDQEAYFQVDDELQLTEKIKKAIDTPLQRIDYLMDDYNWNVIAEQVSEVYKKVI
C

Enzyme Prediction     

No EC number prediction in MGYG000000343_02619.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT4	191	332	8.7e-29	0.90625

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03801	GT4_PimA-like	1.93e-49	8	357	6	366	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
COG0438	RfaB	2.50e-37	1	360	1	378	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03809	GT4_MtfB-like	2.58e-36	9	352	7	360	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.
cd03811	GT4_GT28_WabH-like	1.19e-32	15	345	11	342	family 4 and family 28 glycosyltransferases similar to Klebsiella WabH. This family is most closely related to the GT1 family of glycosyltransferases. WabH in Klebsiella pneumoniae has been shown to transfer a GlcNAc residue from UDP-GlcNAc onto the acceptor GalUA residue in the cellular outer core.
cd04955	GT4-like	1.69e-32	2	357	1	379	glycosyltransferase family 4 proteins. This family is most closely related to the GT4 family of glycosyltransferases. Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found in certain bacteria and Archaea.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QUT23979.1	5.67e-170	1	359	1	359
AFL79239.1	7.02e-170	1	358	1	358
QNL37901.1	1.62e-169	1	360	1	360
QJR77151.1	3.14e-165	1	360	1	361
AII63545.1	3.14e-165	1	360	1	361

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5D00_A	6.83e-07	1	356	3	372	Crystalstructure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D00_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate and UMP [Bacillus subtilis subsp. subtilis str. 168],5D01_A Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168],5D01_B Crystal structure of BshA from B. subtilis complexed with N-acetylglucosaminyl-malate [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59002	2.49e-17	1	357	1	382	Uncharacterized glycosyltransferase MJ1607 OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1607 PE=3 SV=1
P26402	1.70e-12	126	353	123	346	Protein RfbU OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=rfbU PE=3 SV=1
P54490	3.17e-12	87	359	73	352	Uncharacterized glycosyltransferase YqgM OS=Bacillus subtilis (strain 168) OX=224308 GN=yqgM PE=3 SV=2
Q65CC7	5.12e-10	83	359	87	384	Alpha-D-kanosaminyltransferase OS=Streptomyces kanamyceticus OX=1967 GN=kanE PE=1 SV=1
O32272	5.17e-10	41	299	57	316	Putative teichuronic acid biosynthesis glycosyltransferase TuaC OS=Bacillus subtilis (strain 168) OX=224308 GN=tuaC PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000051	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000343_02619.