CAZyme Information: MGYG000000343_02640

Basic Information

• Species: Odoribacter sp900548135
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Marinifilaceae; Odoribacter; Odoribacter sp900548135
• CAZyme ID: MGYG000000343_02640
• CAZy Family: GH29
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
484	MGYG000000343_28|CGC1	55897.7	6.9011

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000343	3841231	MAG	Sweden	Europe

• Gene Location: Start: 19476; End: 20930 Strand: +

Full Sequence      

MIPHPWLLLCILLVLSCSGTKKTIRPTPGQQAMIDRKYGMFLHYGMNTYLDKEWSDGTTP
ASTFNPPEEMAAKIENWVTTAKNAGMRSIVLPVKHHDGFCLWNTQYTDYSTAHPAILHPI
DVVKTLSDACHKHGITFSIYYSLWDRHDPSYKKEDPHEYIVFMKNQLQELMTQYGEIGEL
WLDGVWDRKNEKWYLQEIYDFVKSMQPQCQISTNWTLNKRPIDMHEGDSIVYFPADFRLW
DPYLPMANDPKIYSHHGEKYYLPFECTQTISVLGNWFYHPQDTLFRNVDDLEEIFFKATR
NDNCLLLNVPPDGNGNFHPKAVEQIIKLAERLNIKGGKPFPKKLKQPHSLMSDVTTSVSS
VYKNDSLHYGAYCLTDGDVSTSWKCNEKKGWFVMDLGRPCTFQQVQLIEQANYIKNYTLE
ITDGPDDNWKIVHSGTALSNPELSSFMGYGYGEIHLSKPVNARKIRFTIQTATNTPAIYS
VRLK

Enzyme Prediction     

No EC number prediction in MGYG000000343_02640.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH29	31	335	1.7e-63	0.8583815028901735
CBM32	362	476	2e-17	0.8467741935483871

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01120	Alpha_L_fucos	3.81e-41	35	336	24	332	Alpha-L-fucosidase.
COG3669	AfuC	1.04e-39	26	337	11	317	Alpha-L-fucosidase [Carbohydrate transport and metabolism].
smart00812	Alpha_L_fucos	2.89e-36	35	336	25	334	Alpha-L-fucosidase. O-Glycosyl hydrolases (EC 3.2.1.-) are a widespread group of enzymes that hydrolyse the glycosidic bond between two or more carbohydrates, or between a carbohydrate and a non-carbohydrate moiety. A classification system for glycosyl hydrolases, based on sequence similarity, has led to the definition of 85 different families. This classification is available on the CAZy (CArbohydrate-Active EnZymes) web site. Because the fold of proteins is better conserved than their sequences, some of the families can be grouped in 'clans'. Family 29 encompasses alpha-L-fucosidases, which is a lysosomal enzyme responsible for hydrolyzing the alpha-1,6-linked fucose joined to the reducing-end N-acetylglucosamine of the carbohydrate moieties of glycoproteins. Deficiency of alpha-L-fucosidase results in the lysosomal storage disease fucosidosis.
pfam00754	F5_F8_type_C	4.53e-10	368	481	11	124	F5/8 type C domain. This domain is also known as the discoidin (DS) domain family.
cd07583	nitrilase_5	0.003	64	136	11	76	Uncharacterized subgroup of the nitrilase superfamily (putative class 13 nitrilases). The nitrilase superfamily is comprised of nitrile- or amide-hydrolyzing enzymes and amide-condensing enzymes, which depend on a Glu-Lys-Cys catalytic triad. This superfamily has been classified in the literature based on global and structure based sequence analysis into thirteen different enzyme classes (referred to as 1-13). Class 13 represents proteins that at the time were difficult to place in a distinct similarity group; this subgroup represents either a new class or one that was included previously in class 13. Members of this superfamily generally form homomeric complexes, the basic building block of which is a homodimer.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QRO24262.1	2.67e-210	16	484	22	490
QCQ30775.1	1.25e-208	16	484	22	490
QCQ35194.1	5.06e-208	16	484	22	490
QTO26591.1	7.17e-208	16	484	22	490
QRY59801.1	1.20e-115	11	483	9	491

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5K9H_A	9.17e-46	26	478	39	457	Crystalstructure of a glycoside hydrolase 29 family member from an unknown rumen bacterium [unidentified]
4ZRX_A	1.04e-43	26	330	32	350	Crystalstructure of a putative alpha-L-fucosidase (BACOVA_04357) from Bacteroides ovatus ATCC 8483 at 1.59 A resolution [Bacteroides ovatus ATCC 8483]
6ORG_A	5.89e-41	26	483	11	447	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORG_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6OR4_A	2.91e-40	26	483	11	447	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6OR4_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_A Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORH_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]
6ORF_A	2.96e-40	26	483	11	447	Crystalstructure of SpGH29 [Streptococcus pneumoniae TIGR4],6ORF_B Crystal structure of SpGH29 [Streptococcus pneumoniae TIGR4]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8GW72	5.30e-47	24	478	34	471	Alpha-L-fucosidase 1 OS=Arabidopsis thaliana OX=3702 GN=FUC1 PE=1 SV=2
Q7XUR3	2.53e-36	40	446	54	449	Putative alpha-L-fucosidase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=Os04g0560400 PE=3 SV=2
P10901	5.63e-12	25	334	31	355	Alpha-L-fucosidase OS=Dictyostelium discoideum OX=44689 GN=alfA PE=3 SV=1
P49713	2.36e-10	25	215	28	245	Putative alpha-L-fucosidase OS=Caenorhabditis elegans OX=6239 GN=W03G11.3 PE=3 SV=2
Q9VTJ4	3.21e-10	25	368	44	381	Putative alpha-L-fucosidase OS=Drosophila melanogaster OX=7227 GN=Fuca PE=2 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000655	0.951206	0.047500	0.000213	0.000206	0.000203

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000343_02640.