CAZyme Information: MGYG000000345_00212

Basic Information

• Species: UBA1829 sp002338895
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp002338895
• CAZyme ID: MGYG000000345_00212
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
530	MGYG000000345_1|CGC4	60334.17	8.0012

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000345	3773289	MAG	Sweden	Europe

• Gene Location: Start: 257094; End: 258686 Strand: +

Full Sequence      

MSENRPKFSHLDPITRDFAETHPDTCAAVTATGKQKIYYGVLILFLLFLLKYRWDLFVFL
VCGSLMLLYGGAVLMRLAAGICTVCGFGTEKVKQEELDALTDDSLPVYTILLPLYKEPEV
AQKILKRIGALDYPASKLDVKLLLESDDAETAAELEKTTLPPSFSILRIPDAQPKTKPRA
CNFGLREAKGEFCVIYDAEDIPDRDQLKKSVVVFRRDKDHRLACVQAKLNYYNSRQNILT
GFFTVEYTTYFDLVLAGWQKFNMPLPLGGTSNHFRTEYLRAIGGWDPFNVTEDCELGIRI
YENHWKTTVLDSTTLEEANSRLWNWMRQRSRWVKGFIQTHLAHYRNPIATIRRLGLYGAV
GGYMAVGGSALMMLTNLIYWPLTLLYLFLLIHGLSAGESLESLLVASTSRESVYQGVDFA
GIHWRVWPMLYTGPGESPFWSLVSQIFCAGTVFLFLSNLLLVGIHLAAVLKRRYFHLTIH
ALLMPFYWILISCGAWKGFLQIFTKPFYWEKTVHGLDADFNKKLQGESVV

Enzyme Prediction     

No EC number prediction in MGYG000000345_00212.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	108	334	4.6e-24	0.9782608695652174

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06427	CESA_like_2	6.68e-143	106	347	1	241	CESA_like_2 is a member of the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, Glucan Biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of glucan.
COG1215	BcsA	2.28e-44	54	381	10	329	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06423	CESA_like	8.57e-41	110	293	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
cd06421	CESA_CelA_like	7.58e-28	106	339	1	233	CESA_CelA_like are involved in the elongation of the glucan chain of cellulose. Family of proteins related to Agrobacterium tumefaciens CelA and Gluconacetobacter xylinus BscA. These proteins are involved in the elongation of the glucan chain of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues. They are putative catalytic subunit of cellulose synthase, which is a glycosyltransferase using UDP-glucose as the substrate. The catalytic subunit is an integral membrane protein with 6 transmembrane segments and it is postulated that the protein is anchored in the membrane at the N-terminal end.
cd06437	CESA_CaSu_A2	2.43e-25	106	336	1	232	Cellulose synthase catalytic subunit A2 (CESA2) is a catalytic subunit or a catalytic subunit substitute of the cellulose synthase complex. Cellulose synthase (CESA) catalyzes the polymerization reaction of cellulose using UDP-glucose as the substrate. Cellulose is an aggregate of unbranched polymers of beta-1,4-linked glucose residues, which is an abundant polysaccharide produced by plants and in varying degrees by several other organisms including algae, bacteria, fungi, and even some animals. Genomes from higher plants harbor multiple CESA genes. There are ten in Arabidopsis. At least three different CESA proteins are required to form a functional complex. In Arabidopsis, CESA1, 3 and 6 and CESA4, 7 and 8, are required for cellulose biosynthesis during primary and secondary cell wall formation. CESA2 is very closely related to CESA6 and is viewed as a prime substitute for CESA6. They functionally compensate each other. The cesa2 and cesa6 double mutant plants were significantly smaller, while the single mutant plants were almost normal.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44806.1	5.87e-220	11	516	8	512
ANH37163.1	1.96e-124	10	517	245	706
ABL80246.1	3.00e-124	10	517	141	602
QKE00159.1	6.19e-122	10	518	258	720
QWF23056.1	6.62e-121	10	518	243	705

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EJ1_A	1.37e-08	100	348	122	385	ChainA, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
4HG6_A	1.43e-08	100	348	134	397	ChainA, Cellulose Synthase Subunit A [Cereibacter sphaeroides]
4P00_A	1.43e-08	100	348	135	398	ChainA, Cellulose Synthase A subunit [Cereibacter sphaeroides 2.4.1],4P02_A Chain A, Cellulose Synthase subunit A [Cereibacter sphaeroides 2.4.1],5EIY_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1],5EJZ_A Chain A, Putative cellulose synthase [Cereibacter sphaeroides 2.4.1]
6YV7_B	1.23e-06	106	211	42	149	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	1.24e-06	106	211	43	150	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P96587	5.57e-19	105	335	48	279	Uncharacterized glycosyltransferase YdaM OS=Bacillus subtilis (strain 168) OX=224308 GN=ydaM PE=3 SV=1
Q8LIY0	3.76e-14	103	338	230	471	Probable xyloglucan glycosyltransferase 1 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC1 PE=3 SV=1
Q6L538	1.52e-13	106	338	230	468	Probable xyloglucan glycosyltransferase 7 OS=Oryza sativa subsp. japonica OX=39947 GN=CSLC7 PE=2 SV=1
Q9LJP4	4.58e-13	91	338	184	437	Xyloglucan glycosyltransferase 4 OS=Arabidopsis thaliana OX=3702 GN=CSLC4 PE=1 SV=1
P74165	9.89e-13	94	515	92	467	Beta-monoglucosyldiacylglycerol synthase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=sll1377 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.999951	0.000034	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
37	56
66	88
354	376
439	461
474	496