CAZyme Information: MGYG000000345_00478

Basic Information

• Species: UBA1829 sp002338895
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp002338895
• CAZyme ID: MGYG000000345_00478
• CAZy Family: GH10
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
438		51089.49	5.6222

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000345	3773289	MAG	Sweden	Europe

• Gene Location: Start: 228593; End: 229909 Strand: -

Full Sequence      

MNEYAQNLCQRLVKEDAEVEFRIKTGTEMYRKGFGRIELQYADGSPVENASLKFKQISHE
YLFGCNAFMFNQFPEEEQNRKYEEVFANLFNEAVVPFYWSDFELEDGNPRFASGSTPVYR
RPPTDEVVNFCKRHGITPKGHPLCWHLFVPEWAPKKKSEMIKRLGRRIREIAEHYGDDIQ
IWDTVNEAQSRNPVRRGFDNPAFPDNHVEEIFRIADRYLPFATLLYNDDNKWFQYNGDYT
PVYLLVKSLQEHGCRVGGLGLQFHMFSRLLEQADLFLNPRQILKCLDQYGKLNIPVNFSE
VSVISSRDLGDGDAFQELVTEKLYRLWFSHPATNAIVWWNLVDGTAAYAPLGSEQGENSL
RAGLVNYDFTPKPAYRILEQLIKHEWHTETTLDYHRPAENMFHGFYGDYETTIQTDKGTF
TRTISLSKDSDNMIRITL

Enzyme Prediction     

No EC number prediction in MGYG000000345_00478.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH10	77	377	5.7e-46	0.9141914191419142

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00633	Glyco_10	1.08e-40	123	375	17	260	Glycosyl hydrolase family 10.
pfam00331	Glyco_hydro_10	1.28e-33	77	375	22	305	Glycosyl hydrolase family 10.
COG3693	XynA	3.80e-29	99	384	69	344	Endo-1,4-beta-xylanase, GH35 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM44415.1	3.19e-204	1	429	3	431
QHV94149.1	2.61e-105	16	438	28	445
QIP12711.1	3.69e-105	16	438	28	445
QMW04637.1	4.32e-101	16	438	28	446
AEI51978.1	4.31e-100	15	437	27	440

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
3NIY_A	4.02e-23	71	383	39	337	Crystalstructure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NIY_B Crystal structure of native xylanase 10B from Thermotoga petrophila RKU-1 [Thermotoga petrophila RKU-1],3NJ3_A Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1],3NJ3_B Crystal structure of xylanase 10B from Thermotoga petrophila RKU-1 in complex with xylobiose [Thermotoga petrophila RKU-1]
1VBR_A	4.53e-23	71	383	23	321	Crystalstructure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBR_B Crystal structure of complex xylanase 10B from Thermotoga maritima with xylobiose [Thermotoga maritima],1VBU_A Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima],1VBU_B Crystal structure of native xylanase 10B from Thermotoga maritima [Thermotoga maritima]
7D88_A	7.31e-21	46	436	71	421	ChainA, Beta-xylanase [Bacillus sp. (in: Bacteria)]
7NL2_A	1.59e-20	85	383	30	343	ChainA, Beta-xylanase [Pseudothermotoga thermarum DSM 5069],7NL2_B Chain B, Beta-xylanase [Pseudothermotoga thermarum DSM 5069]
7D89_A	5.90e-20	46	436	71	421	ChainA, Beta-xylanase [Bacillus sp. (in: Bacteria)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q12603	4.10e-21	82	325	57	287	Beta-1,4-xylanase OS=Dictyoglomus thermophilum OX=14 GN=xynA PE=3 SV=1
Q60041	8.12e-20	119	383	82	340	Endo-1,4-beta-xylanase B OS=Thermotoga neapolitana OX=2337 GN=xynB PE=3 SV=1
O80596	2.15e-18	43	428	706	1052	Endo-1,4-beta-xylanase 2 OS=Arabidopsis thaliana OX=3702 GN=XYN2 PE=3 SV=1
Q02290	6.16e-18	118	383	74	326	Endo-1,4-beta-xylanase B OS=Neocallimastix patriciarum OX=4758 GN=xynB PE=2 SV=1
P40944	7.09e-18	125	326	415	625	Endo-1,4-beta-xylanase A OS=Caldicellulosiruptor sp. (strain Rt8B.4) OX=28238 GN=xynA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000003	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000345_00478.