CAZyme Information: MGYG000000345_01286

Basic Information

• Species: UBA1829 sp002338895
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp002338895
• CAZyme ID: MGYG000000345_01286
• CAZy Family: GT83
• CAZyme Description: Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
552		63213.67	9.9679

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000345	3773289	MAG	Sweden	Europe

• Gene Location: Start: 227851; End: 229509 Strand: +

Full Sequence      

MKKALLLLIVLIILLYLIPLNVRVMFSPDETRYAEIGREMIASGDWVTPRLNGVLYFEKP
VFGYWAFAVSQLLFGEHAFAIRLPCVLATLLSALALFFLTRRFSGGGEKVGLLASTVFLL
TPLVFALGIAATLDPIFSAFLTIAMVFFYYAAQTEKLERAGYLFLFGLAAGLAFLTKGFL
AFVLPGLSIFAWLLWTRRWKEMITLPWIPLIGVLLVVLPWAILIHLDQPAYWEYFIYDEH
IKRFLEKEQHPEPFWFFIPVLLGGLGWLLFLTPSAVKGFVRENWKEDFIRYLVCWFALPF
VFLSLSSGKLATYILPCFAPLAVLLAIGLYRTVVEKRDEKLLDVLLLVFAGALALAAVGL
VSVQLSGVKWTLFAKGEGWKWVIFTLTGIILMVSLVFAVQEKKNPWMKLGFFFVGLCPLL
FVMHFALPDLLVLRRSASGLLESVRDRITPETKLLSFRYPFQDVNWVFKRSDVYMYRAPG
EIRWGLEYDPAMKERRLLDREKTNELIRRMRGKGGVLLVLPTKVYLEDREKLPKPEWVKS
TPHRKGYTAVKF

Enzyme Prediction     

No EC number prediction in MGYG000000345_01286.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT83	3	504	5.8e-118	0.9277777777777778

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK13279	arnT	8.41e-111	21	535	24	536	lipid IV(A) 4-amino-4-deoxy-L-arabinosyltransferase.
COG1807	ArnT	9.35e-51	27	520	32	529	4-amino-4-deoxy-L-arabinose transferase or related glycosyltransferase of PMT family [Cell wall/membrane/envelope biogenesis].
pfam13231	PMT_2	4.65e-15	59	222	2	159	Dolichyl-phosphate-mannose-protein mannosyltransferase. This family contains members that are not captured by pfam02366.
pfam02366	PMT	5.76e-15	24	235	26	245	Dolichyl-phosphate-mannose-protein mannosyltransferase. This is a family of Dolichyl-phosphate-mannose-protein mannosyltransferase proteins EC:2.4.1.109. These proteins are responsible for O-linked glycosylation of proteins, they catalyze the reaction:- Dolichyl phosphate D-mannose + protein <=> dolichyl phosphate + O-D-mannosyl-protein. Also in this family is Drosophila rotated abdomen protein which is a putative mannosyltransferase. This family appears to be distantly related to pfam02516 (A Bateman pers. obs.). This family also contains sequences from ArnTs (4-amino-4-deoxy-L-arabinose lipid A transferase). They catalyze the addition of 4-amino-4-deoxy-l-arabinose (l-Ara4N) to the lipid A moiety of the lipopolysaccharide. This is a critical modification enabling bacteria (e.g. Escherichia coli and Salmonella typhimurium) to resist killing by antimicrobial peptides such as polymyxins. Members such as undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase are predicted to have 12 trans-membrane regions. The N-terminal portion of these proteins is hypothesized to have a conserved glycosylation activity which is shared between distantly related oligosaccharyltransferases ArnT and PglB families.
COG4346	COG4346	3.06e-04	57	236	134	298	Predicted membrane-bound dolichyl-phosphate-mannose-protein mannosyltransferase [Posttranslational modification, protein turnover, chaperones].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QSH42096.1	5.77e-113	2	507	3	512
QSH42095.1	2.86e-109	1	537	1	537
BCL61706.1	2.24e-106	15	552	17	554
CBX27700.1	4.14e-105	2	535	6	544
AVM46371.1	1.09e-95	13	509	14	520

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5EZM_A	6.03e-31	16	354	45	389	CrystalStructure of ArnT from Cupriavidus metallidurans in the apo state [Cupriavidus metallidurans CH34],5F15_A Crystal Structure of ArnT from Cupriavidus metallidurans bound to Undecaprenyl phosphate [Cupriavidus metallidurans CH34]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
C5BDQ8	1.00e-93	10	520	12	519	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Edwardsiella ictaluri (strain 93-146) OX=634503 GN=arnT PE=3 SV=1
A4WAM1	4.28e-88	14	538	16	538	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Enterobacter sp. (strain 638) OX=399742 GN=arnT PE=3 SV=1
A8FRR0	2.74e-87	13	491	17	490	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Shewanella sediminis (strain HAW-EB3) OX=425104 GN=arnT PE=3 SV=1
B2VBI7	1.28e-86	16	536	18	536	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=arnT PE=3 SV=1
Q6D2F3	1.06e-85	9	544	14	545	Undecaprenyl phosphate-alpha-4-amino-4-deoxy-L-arabinose arabinosyl transferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) OX=218491 GN=arnT PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.089533	0.907685	0.000811	0.000550	0.000642	0.000737

TMHMM  Annotations     

start	end
4	26
78	100
110	129
136	153
173	195
202	224
254	276
288	305
310	332
344	366
381	399
406	428