CAZyme Information: MGYG000000345_01838

Basic Information

• Species: UBA1829 sp002338895
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp002338895
• CAZyme ID: MGYG000000345_01838
• CAZy Family: GH39
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1136		130692.34	9.7299

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000345	3773289	MAG	Sweden	Europe

• Gene Location: Start: 50020; End: 53430 Strand: -

Full Sequence      

MLRKIFFCSLFSICSLLSGKEVIDFGDSGHPLKFYASGKHFPVIASDGTPMRLFQAGKKY
YEIRLREKKLYWKAPVFELDLKLDLPEKDSVKIVALHLEDADGELVIFNKELKKAGKGVS
HLVWQFSSNIPQYCFEARKAKNKKLDFPIRIRGFGILFEPSAVEKQTGIRLGKLNMIRGD
EETRSLAHSIFPALHYPDGLFFGMPTVRNAELVQREKDVFLHLRKGSSELVIPQGRGLRS
FYSNMEKIRIRMECDRDHVALSPYLLKEKGGRIPLSQQLLRKGKHELVFSVPDKLHGEGK
LKFGGFCFKSAEEASISIQEIELFIPQPFLQGIRVEKTEQKLGLILPETKQRRASIGFRN
TMEDKADVEVQLSLRDHEKELRKETHLLHLLPGQTVRLYMPEMKKEGIYFLHYSLKQPGK
ADLRRGKISFAVMTPSGPAAPEENPFFFGIQMHAQRFSPFEQALAAEAYQLAGIRLIRNG
AQWGSVQPKKGVWNFQELEGRIRRFRKRGVAFIGSLSATPKWAKRKDWVPYKAKNEVYFP
HRWPGGYPPDHEAFREWAKGLASHFPNGTFPFYELQNEPDHISFCNYSPEELAELQKIAA
EEIRKIDPEAKIMTGGFMAVIPQVYFLEPKYMEKNLKAGKGFYDVIAIHCHGTFETYTPE
IEYLLDMRKRLGIETIPWFPSETGIPSVNFSELEQAQTLFKKLIYSWANGAIGYMWYDFK
NDGRNAWEAEHNFGIYTYDLEPKAGYPVYNALTRLLKRANFKKDHSDHQIFLYEFRDREK
SYYPCWSNTVPVSADRPFWMLNSPEAQVVDLFGNTESLENFHGAFLLQSEQIPRTFIVKN
QYSPRFSPFLTDAEFHVQQGKATVGFTLHNPLRVPIRGRIFPEKESPISFRDRSFEIPAG
GKTPVTLLVSYDGNQMSGKIPLNFSLEGMKQRRIAVLPIKLYSRIPRTEEFRSKPDLRID
RASQMKRLTINAPGEHQLWRGAEDLSAALFLNHSEAALKLKVVVRDDVHCQTYRGRDVWR
GDNVQLCLSLPGGKRFLEIGLTHLPNGKNEVCFWNAAPEMNRSNSIQLKTSRNEKEKTTS
YEAVIPWSLIGYSRCPDHLSFNLLVNENDGRGRKLQGALSFPEKDIRSFRTLYFSK

Enzyme Prediction     

No EC number prediction in MGYG000000345_01838.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH39	489	757	3e-18	0.6612529002320185

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd09621	CBM9_like_5	2.83e-46	955	1134	1	188	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other functional domains such as glycosyl hydrolases. The CBM9 module in these architectures may be involved in binding to carbohydrates.
cd09619	CBM9_like_4	2.68e-10	978	1122	29	174	DOMON-like type 9 carbohydrate binding module. Family 9 carbohydrate-binding modules (CBM9) play a role in the microbial degradation of cellulose and hemicellulose (materials found in plants). The domain has previously been called cellulose-binding domain. The polysaccharide binding sites of CBMs with available 3D structure have been found to be either flat surfaces with interactions formed by predominantly aromatic residues (tryptophan and tyrosine), or extended shallow grooves. CBM9 domains found in this uncharacterized heterogeneous subfamily are often located at the C-terminus of longer proteins and may co-occur with various other domains.
cd00241	DOMON_like	2.39e-08	979	1121	12	158	Domon-like ligand-binding domains. DOMON-like domains can be found in all three kindgoms of life and are a diverse group of ligand binding domains that have been shown to interact with sugars and hemes. DOMON domains were initially thought to confer protein-protein interactions. They were subsequently found as a heme-binding motif in cellobiose dehydrogenase, an extracellular fungal oxidoreductase that degrades both lignin and cellulose, and in ethylbenzene dehydrogenase, an enzyme that aids in the anaerobic degradation of hydrocarbons. The domain interacts with sugars in the type 9 carbohydrate binding modules (CBM9), which are present in a variety of glycosyl hydrolases, and it can also be found at the N-terminus of sensor histidine kinases.
cd21510	agarase_cat	5.61e-06	519	620	39	156	alpha-beta barrel catalytic domain of agarase, such as GH86-like endo-acting agarases identified in non-marine organisms. Typically, agarases (E.C. 3.2.1.81) are found in ocean-dwelling bacteria since agarose is a principle component of red algae cell wall polysaccharides. Agarose is a linear polymer of alternating D-galactose and 3,6-anhydro-L-galactopyranose. Endo-acting agarases, such as glycoside hydrolase 16 (GH16) and GH86 hydrolyze internal beta-1,4 linkages. GH86-like endo-acting agarase of this protein family has been identified in the human intestinal bacterium Bacteroides uniformis. This acquired metabolic pathway, as demonstrated by the prevalence of agar-specific genetic cluster called polysaccharide utilization loci (PULs), varies considerably between human populations, being much more prevalent in a Japanese sample than in North America, European, or Chinese samples. Agarase activity was also identified in the non-marine bacterium Cellvibrio sp.
pfam01229	Glyco_hydro_39	0.007	548	680	121	262	Glycosyl hydrolases family 39.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF94342.1	3.22e-117	384	1114	266	1009
AVM47149.1	1.67e-112	29	1113	201	1282
AVM44759.1	1.47e-93	390	1114	215	941
AHF90198.1	5.59e-93	350	1114	210	982
AVM46276.1	1.08e-89	82	1113	78	1112

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.021672	0.768486	0.208636	0.000433	0.000367	0.000373

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000345_01838.