CAZyme Information: MGYG000000345_02130

Basic Information

• Species: UBA1829 sp002338895
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp002338895
• CAZyme ID: MGYG000000345_02130
• CAZy Family: CE1
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
275		30978.1	6.0845

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000345	3773289	MAG	Sweden	Europe

• Gene Location: Start: 34403; End: 35230 Strand: -

Full Sequence      

MRKPPKDSPKITEHEQMAFLQCNFHSDALGMAASMNVILPQKSRTQIGMGGAEAAAEGAP
VLYLLHGLSDDHTIWMRRTSIERYAATTGLVVVMPSVNRSFYNNTPDGMRFWDYISEELP
ALLPTFFHVSTRREDTFVAGLSMGGFGAFKLALNHPDRYAAAASLSGALRNDWLCAANRK
LYEFDFGPLDQIPGSQNDLYTLAAKVVESDGPRPALFQACGTEDMLYQVNTEFRDHLRRI
GYESTYMEGPGNHCWEYWDARIQDVLNWLPLKDRK

Enzyme Prediction     

No EC number prediction in MGYG000000345_02130.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
CE1	26	269	1.7e-51	0.9779735682819384

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0627	FrmB	2.60e-37	60	270	55	309	S-formylglutathione hydrolase FrmB [Defense mechanisms].
pfam00756	Esterase	1.41e-15	60	269	25	246	Putative esterase. This family contains Esterase D. However it is not clear if all members of the family have the same function. This family is related to the pfam00135 family.
COG2382	Fes	9.63e-12	60	258	99	284	Enterochelin esterase or related enzyme [Inorganic ion transport and metabolism].
PLN02442	PLN02442	1.14e-11	25	159	24	168	S-formylglutathione hydrolase
COG0596	MhpC	1.31e-05	60	158	22	112	Pimeloyl-ACP methyl ester carboxylesterase [Coenzyme transport and metabolism, General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BBL01057.1	2.44e-15	23	264	151	377
AVM58192.1	2.63e-15	24	258	153	385
AHW58566.1	3.58e-15	51	266	174	393
QXN65677.1	6.57e-15	24	266	154	391
QQA30430.1	6.60e-15	24	258	153	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4RGY_A	3.98e-104	17	272	2	264	Structuraland functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12],4RGY_B Structural and functional analysis of a low-temperature-active alkaline esterase from South China Sea marine sediment microbial metagenomic library [uncultured bacterium FLS12]
7L0A_A	1.36e-52	11	269	3	258	ChainA, Esterase family protein [Staphylococcus aureus],7L0A_B Chain B, Esterase family protein [Staphylococcus aureus]
6VH9_A	9.09e-52	18	269	4	252	FphF,Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VH9_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, apo form [Staphylococcus aureus],6VHD_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHD_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT129 bound [Staphylococcus aureus],6VHE_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6VHE_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, KT130 bound [Staphylococcus aureus],6WCX_A FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_B FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_C FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus],6WCX_D FphF, Staphylococcus aureus fluorophosphonate-binding serine hydrolases F, substrate bound [Staphylococcus aureus]
4ROT_A	1.04e-50	17	275	8	263	Crystalstructure of esterase A from Streptococcus pyogenes [Streptococcus pyogenes]
2UZ0_A	3.49e-47	18	271	6	254	TheCrystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_B The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_C The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae],2UZ0_D The Crystal crystal structure of the estA protein, a virulence factor estA protein from Streptococcus pneumonia [Streptococcus pneumoniae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P23553	1.53e-34	17	269	1	261	Acetyl esterase OS=Caldicellulosiruptor saccharolyticus OX=44001 GN=xynC PE=4 SV=1
A7ZX03	6.64e-13	25	166	20	169	S-formylglutathione hydrolase FrmB OS=Escherichia coli O9:H4 (strain HS) OX=331112 GN=frmB PE=3 SV=1
Q3Z551	6.64e-13	25	166	20	169	S-formylglutathione hydrolase FrmB OS=Shigella sonnei (strain Ss046) OX=300269 GN=frmB PE=3 SV=1
A7ZIA3	6.64e-13	25	166	20	169	S-formylglutathione hydrolase FrmB OS=Escherichia coli O139:H28 (strain E24377A / ETEC) OX=331111 GN=frmB PE=3 SV=1
B1LIP0	2.31e-12	25	166	20	169	S-formylglutathione hydrolase FrmB OS=Escherichia coli (strain SMS-3-5 / SECEC) OX=439855 GN=frmB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000076	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000345_02130.