CAZyme Information: MGYG000000345_02239

Basic Information

• Species: UBA1829 sp002338895
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp002338895
• CAZyme ID: MGYG000000345_02239
• CAZy Family: GH2
• CAZyme Description: Beta-glucuronidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572		65544.31	5.7598

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000345	3773289	MAG	Sweden	Europe

• Gene Location: Start: 40079; End: 41797 Strand: -

Full Sequence      

MRTYPLYPERSITDLNGIWQFRFLEKTFLEDADEESFTPNDVMCVPGAFDATPAYRCKRG
TGLYRREFRLWKDSPRGILKVGAIGLRARFRIDGKEVGFTNLPYSGVEFETGPLKAGVHV
ITAAVDNNFDRPAVQYAAGDRMKLFLPYYDFYAFGGFYRGIELHQLPSGTILDRVQVRTL
SHETGRVALRFLFSEACAEKRTVRFRFDTDSDYRTAEIAHGETLECTVPSFRLWSCEKPE
LHTLEVRTQDDVIVERFGIRTVQAGKRQILLNGKPVYLKGFNRHESHPEFGPATPEAVML
EDLQNLRDLHCNFVRGCHYSQDPRFLDFCDEYGMLVWEESLGWGNTAEQMADPEFQDLVE
EETRLMIRNSINHPSVIFWAFLNEFHSHSPEGRHLCERLVKAVKEEDDSRLVTFASCHPN
DDICSDLLDVVAYNIYPGWIGDHLQGVEPPDEIPPMQKKTIAYYRSRTSPDKPIMVSEMG
CCGIYGQRDLAKTQWSEEFQAEYVSAVIRTVASAGGELCGLTIWQFTDAMSFHRTGQDIR
CKPLGLNLAGVFDKYRRRKLAADAVKELYEKL

Enzyme Prediction     

No EC number prediction in MGYG000000345_02239.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	9	569	1.8e-88	0.6117021276595744

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10150	PRK10150	2.40e-62	6	567	2	590	beta-D-glucuronidase; Provisional
COG3250	LacZ	4.31e-54	1	571	1	597	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10340	ebgA	4.99e-37	15	431	44	486	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02836	Glyco_hydro_2_C	2.57e-36	266	571	5	299	Glycosyl hydrolases family 2, TIM barrel domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities.
PRK09525	lacZ	2.08e-22	223	412	291	485	beta-galactosidase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AVM47139.1	1.24e-159	1	569	64	622
AVM46586.1	5.27e-152	1	567	1	556
QZD54105.1	2.36e-109	2	571	3	555
QYY34828.1	1.45e-107	9	571	5	562
QPC80831.1	1.72e-107	2	572	3	560

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6NCW_A	1.45e-72	1	572	2	555	Crystalstructure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_B Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_C Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCW_D Crystal structure of a GH2 beta-galacturonidase from Eisenbergiella tayi bound to glycerol [Eisenbergiella tayi],6NCX_A Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_B Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_C Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi],6NCX_D Crystal structure of GH2 beta-galacturonidase from Eisenbergiella tayi bound to galacturonate [Eisenbergiella tayi]
6U7J_A	1.21e-44	10	572	19	593	UnculturedClostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_B Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_C Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.],6U7J_D Uncultured Clostridium sp. Beta-glucuronidase [uncultured Clostridium sp.]
4JKM_A	8.83e-44	4	567	6	590	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
6D50_A	1.13e-42	5	546	28	595	Bacteroidesuniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii],6D50_B Bacteroides uniforms beta-glucuronidase 2 bound to D-glucaro-1,5-lactone [Bacteroides uniformis str. 3978 T3 ii]
4JKK_A	5.14e-42	4	567	6	586	CrystalStructure of Streptococcus agalactiae beta-glucuronidase in space group I222 [Streptococcus agalactiae 2603V/R],4JKL_A Crystal Structure of Streptococcus agalactiae beta-glucuronidase in space group P21212 [Streptococcus agalactiae 2603V/R],4JKL_B Crystal Structure of Streptococcus agalactiae beta-glucuronidase in space group P21212 [Streptococcus agalactiae 2603V/R]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
O77695	3.38e-39	6	572	25	626	Beta-glucuronidase (Fragment) OS=Chlorocebus aethiops OX=9534 GN=GUSB PE=2 SV=1
P05804	5.54e-39	8	562	8	581	Beta-glucuronidase OS=Escherichia coli (strain K12) OX=83333 GN=uidA PE=1 SV=2
O18835	2.48e-37	8	572	34	628	Beta-glucuronidase OS=Canis lupus familiaris OX=9615 GN=GUSB PE=1 SV=1
Q4FAT7	3.38e-37	6	572	29	629	Beta-glucuronidase OS=Sus scrofa OX=9823 GN=GUSB PE=3 SV=1
P08236	9.34e-36	8	572	34	629	Beta-glucuronidase OS=Homo sapiens OX=9606 GN=GUSB PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000048	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000345_02239.