CAZyme Information: MGYG000000345_02315

Basic Information

• Species: UBA1829 sp002338895
• Lineage: Bacteria; Verrucomicrobiota; Lentisphaeria; Victivallales; UBA1829; UBA1829; UBA1829 sp002338895
• CAZyme ID: MGYG000000345_02315
• CAZy Family: GT2
• CAZyme Description: Undecaprenyl-phosphate 4-deoxy-4-formamido-L-arabinose transferase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
461	MGYG000000345_15|CGC2	51481.4	8.8764

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000345	3773289	MAG	Sweden	Europe

• Gene Location: Start: 58239; End: 59624 Strand: +

Full Sequence      

MKFQAIKLLKTGTWILAVLSFVGAFHMLGTMNLGNFVVNGFSFVLLMFGLITAIITLGYF
LLQAVLAYFYREAPLLEDSQLPKCTVIVPAYNEGEYVATTLRSVIASDYPADKLEVIAVN
DGSKDDTWDWICKAAQEFPGQIVTKNLLRNGGKRRALYEGIKIATGDIVVTIDSDSAITT
DALRKISAPFAKSNVGAVAGNIRVSNLDEGFIPKMLDVAFAFGFEFVRCAQSLIGSVLCT
PGELSAYRLSAIRPLMEEWVNQTFMGRPSGIGEDRAITSMLLRENWRVEFQHNAIAFTKM
PTNYKTLCKMLIRWTRSDIRENLIMLGVFFRRFEPLNFDLLGLQLNLVVQSIAILLPLVF
LPMAIGGFLMNPLSFLYYTVIGTMVWSAVPAVIYAMRYSRSESVWSFIYGLYSIPCLSWI
CVYSIFTVQNSKWMTRGTTVKQSVLTVTQSISVAPIRDRAA

Enzyme Prediction     

No EC number prediction in MGYG000000345_02315.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT2	85	252	3.8e-34	0.9705882352941176

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06434	GT2_HAS	1.09e-50	84	321	2	235	Hyaluronan synthases catalyze polymerization of hyaluronan. Hyaluronan synthases (HASs) are bi-functional glycosyltransferases that catalyze polymerization of hyaluronan. HASs transfer both GlcUA and GlcNAc in beta-(1,3) and beta-(1,4) linkages, respectively to the hyaluronan chain using UDP-GlcNAc and UDP-GlcUA as substrates. HA is made as a free glycan, not attached to a protein or lipid. HASs do not need a primer for HA synthesis; they initiate HA biosynthesis de novo with only UDP-GlcNAc, UDP-GlcUA, and Mg2+. Hyaluronan (HA) is a linear heteropolysaccharide composed of (1-3)-linked beta-D-GlcUA-beta-D-GlcNAc disaccharide repeats. It can be found in vertebrates and a few microbes and is typically on the cell surface or in the extracellular space, but is also found inside mammalian cells. Hyaluronan has several physiochemical and biological functions such as space filling, lubrication, and providing a hydrated matrix through which cells can migrate.
cd06423	CESA_like	7.75e-47	86	274	1	180	CESA_like is the cellulose synthase superfamily. The cellulose synthase (CESA) superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins. Cellulose synthase catalyzes the polymerization reaction of cellulose, an aggregate of unbranched polymers of beta-1,4-linked glucose residues in plants, most algae, some bacteria and fungi, and even some animals. In bacteria, algae and lower eukaryotes, there is a second unrelated type of cellulose synthase (Type II), which produces acylated cellulose, a derivative of cellulose. Chitin synthase catalyzes the incorporation of GlcNAc from substrate UDP-GlcNAc into chitin, which is a linear homopolymer of beta-(1,4)-linked GlcNAc residues and Glucan Biosynthesis protein catalyzes the elongation of beta-1,2 polyglucose chains of Glucan.
COG1215	BcsA	1.08e-45	40	436	10	422	Glycosyltransferase, catalytic subunit of cellulose synthase and poly-beta-1,6-N-acetylglucosamine synthase [Cell motility].
cd06439	CESA_like_1	7.85e-43	57	305	3	235	CESA_like_1 is a member of the cellulose synthase (CESA) superfamily. This is a subfamily of cellulose synthase (CESA) superfamily. CESA superfamily includes a wide variety of glycosyltransferase family 2 enzymes that share the common characteristic of catalyzing the elongation of polysaccharide chains. The members of the superfamily include cellulose synthase catalytic subunit, chitin synthase, glucan biosynthesis protein and other families of CESA-like proteins.
pfam00535	Glycos_transf_2	2.83e-32	85	252	1	164	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
CBX26966.1	6.13e-122	39	447	58	465
ACN15324.1	1.22e-117	63	436	71	443
BCS52180.1	1.34e-117	45	436	49	439
ACN17701.1	1.16e-112	63	443	64	443
QBH12450.1	1.28e-112	63	437	68	441

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6YV7_B	9.61e-15	64	279	16	226	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6YV7_A	9.68e-15	64	279	17	227	MannosyltransferasePcManGT from Pyrobaculum calidifontis [Pyrobaculum calidifontis JCM 11548],6YV8_A Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP and Mn2+ [Pyrobaculum calidifontis JCM 11548],6YV9_B Mannosyltransferase PcManGT from Pyrobaculum calidifontis in complex with GDP-Man and Mn2+ [Pyrobaculum calidifontis JCM 11548]
6P61_A	4.80e-10	79	245	10	173	Structureof a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_B Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_C Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197],6P61_D Structure of a Glycosyltransferase from Leptospira borgpetersenii serovar Hardjo-bovis (strain JB197) [Leptospira borgpetersenii serovar Hardjo-bovis str. JB197]
5TZE_C	4.54e-08	83	188	2	106	Crystalstructure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZE_E Crystal structure of S. aureus TarS in complex with UDP-GlcNAc [Staphylococcus aureus],5TZI_C Crystal structure of S. aureus TarS 1-349 [Staphylococcus aureus],5TZJ_A Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZJ_C Crystal structure of S. aureus TarS 1-349 in complex with UDP-GlcNAc [Staphylococcus aureus],5TZK_C Crystal structure of S. aureus TarS 1-349 in complex with UDP [Staphylococcus aureus]
5TZ8_A	6.61e-08	83	188	2	106	Crystalstructure of S. aureus TarS [Staphylococcus aureus],5TZ8_B Crystal structure of S. aureus TarS [Staphylococcus aureus],5TZ8_C Crystal structure of S. aureus TarS [Staphylococcus aureus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P04340	3.43e-41	76	437	43	395	N-acetylglucosaminyltransferase OS=Rhizobium leguminosarum bv. viciae OX=387 GN=nodC PE=3 SV=1
Q07755	1.43e-40	76	436	39	394	N-acetylglucosaminyltransferase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / LMG 6465 / NBRC 14845 / NCIMB 13405 / ORS 571) OX=438753 GN=nodC PE=3 SV=2
P72334	1.47e-40	62	438	25	397	N-acetylglucosaminyltransferase OS=Rhizobium sp. (strain N33) OX=103798 GN=nodC PE=3 SV=1
P04341	6.70e-40	76	363	43	330	N-acetylglucosaminyltransferase OS=Rhizobium meliloti (strain 1021) OX=266834 GN=nodC PE=3 SV=1
P17862	3.29e-39	82	437	49	396	N-acetylglucosaminyltransferase OS=Mesorhizobium japonicum (strain LMG 29417 / CECT 9101 / MAFF 303099) OX=266835 GN=nodC PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000026	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
15	37
44	66
347	369
374	396
406	428