CAZyme Information: MGYG000000346_01415

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Lachnospirales; Lachnospiraceae
• CAZyme ID: MGYG000000346_01415
• CAZy Family: GT2
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
289		34379.2	10.0827

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000346	2294646	MAG	Sweden	Europe

• Gene Location: Start: 12; End: 881 Strand: +

Full Sequence      

MENPGIVRAIHQENGGHGEAVNTGLANAAGVYFKVVDSDDWVNEKAYKQILDLLREMVEK
KTNLDMLISNFVYEKEGAKRKKVMNYHAAIPRGEILTWDQVRVFTKWQYILMHSVIYRTQ
MLRDCGLKLPAHTFYVDNIFVYQPLPYVKTLYYLDVNFYRYYIGREDQSVNEKVMISRID
QQIRVNKIMIDEYNLYDKKLIPSRKLRHYMMQYLEIMMTISSIMLIRSGTQENLEKKKEL
WKYLKKKDRRLYFKLRHGIMGRTMNLPGKGGRKVSEMGYKITQKFFGFN

Enzyme Prediction     

No EC number prediction in MGYG000000346_01415.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK10073	PRK10073	4.52e-07	7	170	63	222	putative glycosyl transferase; Provisional
cd00761	Glyco_tranf_GTA_type	1.63e-06	1	76	49	122	Glycosyltransferase family A (GT-A) includes diverse families of glycosyl transferases with a common GT-A type structural fold. Glycosyltransferases (GTs) are enzymes that synthesize oligosaccharides, polysaccharides, and glycoconjugates by transferring the sugar moiety from an activated nucleotide-sugar donor to an acceptor molecule, which may be a growing oligosaccharide, a lipid, or a protein. Based on the stereochemistry of the donor and acceptor molecules, GTs are classified as either retaining or inverting enzymes. To date, all GT structures adopt one of two possible folds, termed GT-A fold and GT-B fold. This hierarchy includes diverse families of glycosyl transferases with a common GT-A type structural fold, which has two tightly associated beta/alpha/beta domains that tend to form a continuous central sheet of at least eight beta-strands. The majority of the proteins in this superfamily are Glycosyltransferase family 2 (GT-2) proteins. But it also includes families GT-43, GT-6, GT-8, GT13 and GT-7; which are evolutionarily related to GT-2 and share structure similarities.
pfam00535	Glycos_transf_2	1.48e-04	1	56	49	105	Glycosyl transferase family 2. Diverse family, transferring sugar from UDP-glucose, UDP-N-acetyl- galactosamine, GDP-mannose or CDP-abequose, to a range of substrates including cellulose, dolichol phosphate and teichoic acids.
COG0463	WcaA	0.001	2	256	56	289	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QJU21240.1	4.52e-143	2	289	55	339
ASN94448.1	6.42e-143	2	289	55	339
QRP40871.1	6.42e-143	2	289	55	339
QIX93006.1	1.50e-141	2	289	55	339
CBL12656.1	8.04e-141	4	289	56	337

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000069	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000346_01415.