CAZyme Information: MGYG000000347_01297

Basic Information

• Species: Tener-01 sp001940985
• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-698; Tener-01; Tener-01 sp001940985
• CAZyme ID: MGYG000000347_01297
• CAZy Family: GH3
• CAZyme Description: Beta-hexosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
520	MGYG000000347_16|CGC1	58296.16	4.9263

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000347	1763421	MAG	Sweden	Europe

• Gene Location: Start: 122; End: 1684 Strand: +

Full Sequence      

MSLKMKQLKDLTLKEKIGQLIVVGFGTKEYDNQINHMVDNYSCGNAILFARNYSDPKQMK
KLCKDIHENIYKKTGVVPFIAIDQEGGMVTRMMSGVTFAPSQMSCSASSVNDAAYLSGKM
LSRDMIRLGLNLDLAPCLEVNPNLSNPMVNIRSYSSNPVTAGNMAKRFIKGLSEYGVLGC
TKHFPGCGEADADDHLEITTINQSKEEIEKIGLVPFKMNIDTPSIMTCHSIFKDLDDVPS
TLSKTVLQGLLRKEMGYKGLIISDCVEMKAIANFCGSANGAVRALVAGCDLILVCETWET
QDEVFNALYKAVEDGVLKEELIDEKVERILSYKEKTLPYLEKYFFENNEEYVPSNENNEL
AQEIVDKSITVVKGKEPKLGKNTLVVAPIPTIASLVEESFEIRSLTNALKAKFPNNDIYE
FVRTSEFKDFLLKEIEKHDDMIFFSYDASMDATQVEAINALLETNKDIYVVSLKGPMDQS
LFKNLKNYMCLYEYTPNSIRAIVKYLNNEIKVEGKLPYGD

Enzyme Prediction     

No EC number prediction in MGYG000000347_01297.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	74	294	3.7e-49	0.9675925925925926

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.43e-83	11	387	1	360	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	1.72e-80	12	331	1	315	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	4.31e-46	47	308	30	293	beta-hexosaminidase; Provisional
PRK15098	PRK15098	4.96e-08	8	333	42	353	beta-glucosidase BglX.
PLN03080	PLN03080	0.001	215	373	249	407	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QVK18519.1	1.13e-119	5	517	1	516
AWI66943.1	1.20e-119	5	517	1	515
AAM23516.1	4.40e-118	5	517	1	523
AAQ01678.1	4.40e-118	5	517	1	523
ABY91501.1	5.16e-115	11	517	1	517

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6K5J_A	8.31e-88	9	517	9	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]
4ZM6_A	2.45e-75	10	517	6	524	Aunique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432],4ZM6_B A unique GCN5-related glucosamine N-acetyltransferase region exist in the fungal multi-domain GH3 beta-N-acetylglucosaminidase [Rhizomucor miehei CAU432]
3BMX_A	1.00e-65	11	517	42	614	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	3.21e-65	11	517	16	588	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	5.82e-65	11	517	46	618	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P40406	5.48e-65	11	517	42	614	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
C4LEY6	1.86e-38	29	295	12	277	Beta-hexosaminidase OS=Tolumonas auensis (strain DSM 9187 / TA4) OX=595494 GN=nagZ PE=3 SV=1
A7MFT1	3.02e-38	20	295	6	279	Beta-hexosaminidase OS=Cronobacter sakazakii (strain ATCC BAA-894) OX=290339 GN=nagZ PE=3 SV=1
B2VDM3	3.05e-37	29	318	12	302	Beta-hexosaminidase OS=Erwinia tasmaniensis (strain DSM 17950 / CFBP 7177 / CIP 109463 / NCPPB 4357 / Et1/99) OX=465817 GN=nagZ PE=3 SV=1
Q0AF74	3.40e-37	44	308	29	296	Beta-hexosaminidase OS=Nitrosomonas eutropha (strain DSM 101675 / C91 / Nm57) OX=335283 GN=nagZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000083	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000347_01297.