CAZyme Information: MGYG000000347_01730

Basic Information

• Species: Tener-01 sp001940985
• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-698; Tener-01; Tener-01 sp001940985
• CAZyme ID: MGYG000000347_01730
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
1175		134930.27	4.6532

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000347	1763421	MAG	Sweden	Europe

• Gene Location: Start: 6217; End: 9744 Strand: +

Full Sequence      

MNYVKKKSIFVILILFVVFLFACGENENSINCKVILNYNMNNLKNEEIYLDENNDKYTLP
VPTSEGYVFLGWENEAGEIIVEILFNVDVKEIHLSAKWKKLDGATYKITYVLNGGKALEN
LRSSYIEGEEYVFPELTNESFEFSGWYESEDFSGERIFSTKNKNSDLVLYAKFINPQIIY
ELNGGYFLDEVKYEYVIGETYRLPYPERDDYFFVDWYETPNFSGEPIKMITSEMNRSITL
YAKWEYLYEIRTIDYILEGGKFNEEVVRTYPEGKGCELPLPTREGYEFLGWYDSDLGRII
YEINSRAVGNKTLIARWEKIYDYSKINYVLNGGIFECDYPERYPETEGIDLVAPKKQGYF
FRGFYTQSDFSGERISRISSTEKGEITLYAKWIEAKLENAYISFYGDSITTFDGYIPEGF
ASYYPAASASVKNVEDTWWYKTILRTNAKLLVNNSYGGTAVYGGKNQGVDEDRIKLLSTN
DIRPDIIIVYFGINDVVNRRTTTLFKDAYIKMVDSIQKIYPESKLFLCTLAYETNTDKYA
PGLREAFSEIIETVANKKNCEIISFDKVLTSDKGLSCLGDSIHPNKNGMDLLSSEAIRTL
NDYYNDNNEYYNIDYDLNGGKILETSYLTTYKNLRVNYKLPIPIRNGYKFLGWFDMNSNK
ITYITPNDKCDFMLKAKWEKIEKSDEVIEVKFIDSNGNEKIKQVKYGESVEKEENVSNEY
IWAVGIEAFDFNEAITSSLIVREIPIYVYEIISSNFTKNVFNDLNLQKKYKTTFGEVSVE
WVSSNKYIIDSTSGRVNPAREETVVSLVGKFTRLSSTITYEIEMIVDKIEFKSLDDIKPT
FAYVYTNTSNIIIDNLTINTIDVANYGFARVTTNGEVSIAELTNLNNVFKLRKYGIRVLL
CIGGYGTMGKEFSDAAFTIEGRKKLAKSIAETIEKYHFDGVDIDWEYPGYETGRDTSVDK
PNYTLLMEEIRKEVKAKNSDYIVSAALPGGIFGYTRYELNKLDNVLDYVHLMTYDLASSA
KVTHHAAPFNGDYTPIGSVEQTVKTYNEGGISKKKLIVGIAFYGRAFYLNEKGENILGST
DINQSNKTITFTNIFSLYLEKSYASDSKVIRYFDEKSKAPYIYDSSNKVAISYDDKESIK
AKLDYVKSNDLGGVMFWDYGEDLHGILLNAIYESK

Enzyme Prediction     

No EC number prediction in MGYG000000347_01730.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	849	1163	4.6e-66	0.8716216216216216

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00636	Glyco_18	7.44e-69	845	1158	6	330	Glyco_18 domain.
cd06548	GH18_chitinase	6.20e-68	845	1162	15	322	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
pfam00704	Glyco_hydro_18	2.13e-64	844	1162	11	307	Glycosyl hydrolases family 18.
COG3325	ChiA	3.67e-54	884	1173	113	434	Chitinase, GH18 family [Carbohydrate transport and metabolism].
cd02872	GH18_chitolectin_chitotriosidase	1.51e-52	865	1173	32	360	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARS42913.1	1.18e-53	865	1174	37	352
QIL41604.1	7.66e-50	865	1174	56	371
ADB39366.1	4.79e-49	829	1171	19	368
AQM59229.1	1.78e-48	865	1174	30	339
QDM46973.1	6.73e-48	876	1174	42	342

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1ITX_A	1.42e-41	884	1171	109	415	ChainA, Glycosyl Hydrolase [Niallia circulans]
6INX_A	1.39e-40	876	1174	41	341	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
6KXN_A	4.79e-40	865	1174	37	369	Crystalstructure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXN_B Crystal structure of W50A mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KST_A	4.79e-40	865	1174	37	369	Crystalstructure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KST_B Crystal structure of the catalytic domain of chitinase ChiL from Chitiniphilus shinanonensis (CsChiL) [Chitiniphilus shinanonensis],6KXL_A Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXL_B Crystal structure of the catalytic domain of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]
6KXM_A	2.18e-39	865	1174	37	369	Crystalstructure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis],6KXM_B Crystal structure of D157N mutant of Chitiniphilus shinanonensis chitinase ChiL (CsChiL) complexed with N,N'-diacetylchitobiose [Chitiniphilus shinanonensis]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P20533	4.65e-39	884	1171	141	447	Chitinase A1 OS=Niallia circulans OX=1397 GN=chiA1 PE=1 SV=1
A6N6J0	1.17e-32	888	1165	113	393	Endochitinase 46 OS=Trichoderma harzianum OX=5544 GN=chit46 PE=1 SV=1
P48827	1.88e-32	885	1165	109	386	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
P32470	3.22e-29	888	1158	114	379	Chitinase 1 OS=Aphanocladium album OX=12942 GN=CHI1 PE=1 SV=2
E9ERT9	1.07e-28	888	1165	115	387	Endochitinase 1 OS=Metarhizium robertsii (strain ARSEF 23 / ATCC MYA-3075) OX=655844 GN=chit1 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000000	0.000002	1.000058	0.000000	0.000000	0.000000

TMHMM  Annotations     

start	end
7	24