CAZyme Information: MGYG000000347_01749

Basic Information

• Species: Tener-01 sp001940985
• Lineage: Bacteria; Firmicutes; Bacilli; ML615J-28; CAG-698; Tener-01; Tener-01 sp001940985
• CAZyme ID: MGYG000000347_01749
• CAZy Family: GH18
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
344		39157.83	4.9878

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000347	1763421	MAG	Sweden	Europe

• Gene Location: Start: 4611; End: 5645 Strand: -

Full Sequence      

MYEFKVKVVGAKDQSRALATGYFYTNFSKITENTIATLDIMYCAFGYIDENGNFTNTSET
SNLIKNLKNYVLPLAKKHGTKVLISVNEKNNSFSSVSQTPELRKKLSENVVSLINTYDLD
GIDIDWEYPDADEVTNFTLLMQEIYNAVKKNNPNHLVTAAIGGGKWQPPRYDLSNSKNYL
DYINLMTYSMTSSHGYFQNALYKSTKGYTLTSCSIDESIKIYDTYNVPHEKILVGVAFYG
IKEENCEGPGTSSDSGKSISYRVLYDTYIKNQPDNVQILYDEESESAYIYDSLNKVFITY
DSERSIARKCEYINTHNLAGIMYWQDGHDADDILLNAIKENIRK

Enzyme Prediction     

No EC number prediction in MGYG000000347_01749.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH18	36	331	3.8e-55	0.8209459459459459

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
smart00636	Glyco_18	2.13e-57	21	329	4	334	Glyco_18 domain.
pfam00704	Glyco_hydro_18	5.87e-56	21	324	4	302	Glycosyl hydrolases family 18.
cd06548	GH18_chitinase	3.45e-53	27	324	33	317	The GH18 (glycosyl hydrolases, family 18) type II chitinases hydrolyze chitin, an abundant polymer of N-acetylglucosamine and have been identified in bacteria, fungi, insects, plants, viruses, and protozoan parasites. The structure of this domain is an eight-stranded alpha/beta barrel with a pronounced active-site cleft at the C-terminal end of the beta-barrel.
cd02872	GH18_chitolectin_chitotriosidase	1.19e-43	32	340	21	360	This conserved domain family includes a large number of catalytically inactive chitinase-like lectins (chitolectins) including YKL-39, YKL-40 (HCGP39), YM1, oviductin, and AMCase (acidic mammalian chitinase), as well as catalytically active chitotriosidases. The conserved domain is an eight-stranded alpha/beta barrel fold belonging to the family 18 glycosyl hydrolases. The fold has a pronounced active-site cleft at the C-terminal end of the beta-barrel. The chitolectins lack a key active site glutamate (the proton donor required for hydrolytic activity) but retain highly conserved residues involved in oligosaccharide binding. Chitotriosidase is a chitinolytic enzyme expressed in maturing macrophages, which suggests that it plays a part in antimicrobial defense. Chitotriosidase hydrolyzes chitotriose, as well as colloidal chitin to yield chitobiose and is therefore considered an exochitinase. Chitotriosidase occurs in two major forms, the large form being converted to the small form by either RNA or post-translational processing. Although the small form, containing the chitinase domain alone, is sufficient for the chitinolytic activity, the additional C-terminal chitin-binding domain of the large form plays a role in processing colloidal chitin. The chitotriosidase gene is nonessential in humans, as about 35% of the population are heterozygous and 6% homozygous for an inactivated form of the gene. HCGP39 is a 39-kDa human cartilage glycoprotein thought to play a role in connective tissue remodeling and defense against pathogens.
COG3325	ChiA	1.15e-39	47	340	93	434	Chitinase, GH18 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AUD65244.1	5.09e-83	4	344	396	742
AUD63190.1	3.36e-82	4	344	389	735
BCR35892.1	1.11e-80	4	344	385	724
CCV65692.1	2.48e-79	4	344	382	728
VEU83132.1	2.07e-76	2	344	379	726

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6INX_A	1.14e-35	29	343	18	343	Structuralinsights into a novel glycoside hydrolase family 18 N-acetylglucosaminidase from Paenibacillus barengoltzii [Paenibacillus barengoltzii]
5GZU_A	2.31e-35	11	331	39	379	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZU_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_A Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7],5GZV_B Crystal Structure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
5GZT_B	2.54e-35	11	331	290	630	CrystalStructure of Chitinase ChiW from Paenibacillus sp. str. FPU-7 Reveals a Novel Type of Bacterial Cell-Surface-Expressed Multi-Modular Enzyme Machinery [Paenibacillus sp. FPU-7]
4NZC_A	4.78e-28	71	342	77	396	Crystalstructure of Chitinase D from Serratia proteamaculans at 1.45 Angstrom resolution [Serratia proteamaculans 568],4Q22_A Crystal structure of Chitinase D from Serratia proteamaculans in complex with N-acetyl glucosamine at 1.93 Angstrom resolution [Serratia proteamaculans 568]
6HM1_A	4.91e-28	71	342	74	393	Structuraland thermodynamic signatures of ligand binding to an enigmatic chitinase-D from Serratia proteamaculans [Serratia proteamaculans 568]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P0CB51	5.14e-27	67	329	109	383	Endochitinase 1 OS=Coccidioides posadasii (strain RMSCC 757 / Silveira) OX=443226 GN=CTS1 PE=1 SV=1
Q1E3R8	5.14e-27	67	329	109	383	Endochitinase 1 OS=Coccidioides immitis (strain RS) OX=246410 GN=CTS1 PE=3 SV=1
C5P230	7.06e-27	81	329	123	383	Endochitinase 1 OS=Coccidioides posadasii (strain C735) OX=222929 GN=CTS1 PE=3 SV=1
P48827	2.40e-26	79	334	121	391	Endochitinase 42 OS=Trichoderma harzianum OX=5544 GN=chit42 PE=1 SV=1
G5EAZ3	5.43e-24	81	342	90	368	Endochitinase B OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) OX=227321 GN=chiB PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000043	0.000002	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000347_01749.