CAZyme Information: MGYG000000348_00166

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000000348_00166
• CAZy Family: GH5
• CAZyme Description: Endoglucanase Z

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
335	MGYG000000348_2|CGC2	37432.58	5.6191

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000348	2655711	MAG	Sweden	Europe

• Gene Location: Start: 56018; End: 57025 Strand: -

Full Sequence      

MKKITAIAAMMLMVGSAAVSCNGAKKQADNTEAQDSTFVTPLHVEGLYLLNAKGDTMVLN
GPSLGWHSNWGRFYNDSTVMAFKKNWGANITRAAIGAHTSWDVVNCYDADSIDAMNKLYR
VIDAAIANDMYVIADWHTHKNTLDNAKKFFTAVTEKYGDTPNILYEIWNEPETVKWDEVK
EYAEEVIPVIRKKAPNSVIIVGSPTWDQDVDIASESPLKYDNLLYSLHFYAATHKQPLID
KAEKAIANGLPLIISECGGMEASGDGPVDEESMRKWVEFADKHKLSMLFWSIADKTETCS
MVTPDASDNGMLWTEEQIKPWGKTAKTIIKKRNHK

Enzyme Prediction     

No EC number prediction in MGYG000000348_00166.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH5	53	287	4.4e-86	0.9831223628691983

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam00150	Cellulase	3.07e-55	50	295	1	271	Cellulase (glycosyl hydrolase family 5).
COG2730	BglC	1.32e-06	30	243	35	236	Aryl-phospho-beta-D-glucosidase BglC, GH1 family [Carbohydrate transport and metabolism].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCP72662.1	7.61e-156	5	333	7	333
QCD38972.1	7.61e-156	5	333	7	333
QRX64947.1	3.84e-98	11	331	1	319
AND74761.1	1.89e-97	1	333	1	332
AWW31171.1	3.10e-97	10	329	9	319

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5IHS_A	4.01e-66	42	333	35	324	Structureof CHU_2103 from Cytophaga hutchinsonii [Cytophaga hutchinsonii ATCC 33406]
1EGZ_A	1.76e-65	39	329	2	284	ChainA, ENDOGLUCANASE Z [Dickeya chrysanthemi],1EGZ_B Chain B, ENDOGLUCANASE Z [Dickeya chrysanthemi],1EGZ_C Chain C, ENDOGLUCANASE Z [Dickeya chrysanthemi]
6GJF_A	7.91e-64	42	331	13	302	Ancestralendocellulase Cel5A [synthetic construct],6GJF_B Ancestral endocellulase Cel5A [synthetic construct],6GJF_C Ancestral endocellulase Cel5A [synthetic construct],6GJF_D Ancestral endocellulase Cel5A [synthetic construct],6GJF_E Ancestral endocellulase Cel5A [synthetic construct],6GJF_F Ancestral endocellulase Cel5A [synthetic construct]
1TVN_A	8.32e-64	39	322	2	292	Cellulasecel5G from Pseudoalteromonas haloplanktis, A family GH 5-2 enzyme [Pseudoalteromonas haloplanktis],1TVN_B Cellulase cel5G from Pseudoalteromonas haloplanktis, A family GH 5-2 enzyme [Pseudoalteromonas haloplanktis],1TVP_A Endoglucanase cel5G from Pseudoalteromonas haloplanktis in complex with cellobiose [Pseudoalteromonas haloplanktis],1TVP_B Endoglucanase cel5G from Pseudoalteromonas haloplanktis in complex with cellobiose [Pseudoalteromonas haloplanktis]
5WH8_A	5.58e-63	42	310	14	291	CellulaseCel5C_n [uncultured organism]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P07103	3.92e-63	39	329	45	327	Endoglucanase Z OS=Dickeya dadantii (strain 3937) OX=198628 GN=celZ PE=1 SV=2
O85465	1.35e-60	1	322	1	319	Endoglucanase 5A OS=Salipaludibacillus agaradhaerens OX=76935 GN=cel5A PE=1 SV=1
P06565	1.31e-59	1	322	1	319	Endoglucanase B OS=Evansella cellulosilytica (strain ATCC 21833 / DSM 2522 / FERM P-1141 / JCM 9156 / N-4) OX=649639 GN=celB PE=3 SV=1
P07983	8.34e-57	42	310	42	311	Endoglucanase OS=Bacillus subtilis OX=1423 GN=bglC PE=3 SV=2
P15704	1.50e-56	32	329	37	335	Endoglucanase OS=Clostridium saccharobutylicum OX=169679 GN=eglA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as LIPO

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000017	0.012931	0.987065	0.000005	0.000007	0.000005

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000348_00166.