CAZyme Information: MGYG000000348_01615

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000000348_01615
• CAZy Family: GH127
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607	MGYG000000348_33|CGC1	68577.75	5.7655

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000348	2655711	MAG	Sweden	Europe

• Gene Location: Start: 323; End: 2146 Strand: -

Full Sequence      

MSVLMLSAVAHGERTVMIGDYVGDRINSCIENRVKCQNTALLVEPFRHLTEGTRWQTEFI
GKWMLGAIASYRYTNEDELLDKIKEAASDLMSTQREDGYIGNYKDTDRLTNWDIWGRKYT
SLALLDYYSLTGDKKALKSVGRLIDGLIDELKTRNVDIAKTGLYRGMASCSILEPVMYLY
RYTSNRKYLDFATEIVSAIEKPGSTRLVTNALENVPVAHRFDFPKKWWSYENGHKAYEMM
SCYVGLIEYGKVVGDGKYLAAAQAAAQNILDTEINVAGSGAAFECWYGGKDRQTIPAYHT
METCVTFTWMQLLDRLWRQTGDSKYADEFERTMYNALMASLRNDGKEISKYSPLEGRRQH
GEEQCGLPINCCNANGPRGFAMIPDFALRTRQDTLFVNLYVPLEAGLDVGKSKLNIKISN
DFPKTGNNKIEISRQGKDDVLLALRIPEWCDGKYRVSVDGRVIDRSPVKGYVTVPVEKGT
TAITADFHLAGKIERINGMQTLTRGPLVFARDNRYNDGDVDECGIIKENENGEVDMEFLS
DGNEFAWCTAEVPMILGTDLEDPENSAGRKVKFCDFGSAGNDWSRDGRYRVWIVAPIHAM
SQPYHKY

Enzyme Prediction     

No EC number prediction in MGYG000000348_01615.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH127	31	510	1.6e-49	0.9465648854961832

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.47e-52	52	510	52	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	6.08e-43	36	510	42	501	Uncharacterized conserved protein, DUF1680 family [Function unknown].
COG4225	YesR	0.004	112	259	34	157	Rhamnogalacturonyl hydrolase YesR [Carbohydrate transport and metabolism].
cd04792	LanM-like	0.006	47	196	524	680	Cyclases involved in the biosynthesis of class II lantibiotics, and similar proteins. LanM-like proteins. LanM is a bifunctional enzyme, involved in the synthesis of class II lantibiotics. It is responsible for both the dehydration and the cyclization of the precursor-peptide during lantibiotic synthesis. The C-terminal domain shows similarity to LanC, the cyclase component of the lan operon, but the N terminus seems to be unrelated to the dehydratase, LanB.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ARE60508.1	2.56e-250	12	607	23	620
QTL99209.1	1.49e-32	52	509	71	563
AZO96465.1	3.62e-32	52	509	71	563
QIX65272.1	7.96e-30	76	593	112	614
QUR48577.1	1.92e-29	76	512	112	551

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
6EX6_A	1.53e-28	179	516	202	554	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
7EXU_A	3.95e-15	52	520	70	576	ChainA, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
3WRE_A	5.15e-15	52	520	70	576	Thecrystal structure of native HypBA1 from Bifidobacterium longum JCM 1217 [Bifidobacterium longum subsp. longum JCM 1217],3WRG_A The complex structure of HypBA1 with L-arabinose [Bifidobacterium longum subsp. longum JCM 1217]
3WKW_A	5.22e-15	52	520	70	576	Crystalstructure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum ligand free form [Bifidobacterium longum subsp. longum JCM 1217],3WKX_A Crystal structure of GH127 beta-L-arabinofuranosidase HypBA1 from Bifidobacterium longum arabinose complex form [Bifidobacterium longum subsp. longum JCM 1217],7BZL_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7DIF_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXV_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217],7EXW_A Chain A, Non-reducing end beta-L-arabinofuranosidase [Bifidobacterium longum subsp. longum JCM 1217]
6YQH_AAA	9.58e-14	302	461	337	504	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	2.82e-14	52	520	70	576	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.951508	0.047876	0.000319	0.000116	0.000059	0.000120

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000348_01615.