CAZyme Information: MGYG000000348_01859

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485
• CAZyme ID: MGYG000000348_01859
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
377		42608.55	9.8848

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000348	2655711	MAG	Sweden	Europe

• Gene Location: Start: 10007; End: 11140 Strand: -

Full Sequence      

MKYVLIAGEASGDLHASHLIKHIRENDPEAEFRFFGGDLMAAEARRNPELHYNRMNVMGF
SEVLRALPRIMANLRQAKALLHTWRPDALVLVDYPGFNLMVAEYAKKSGIPVHYFISPKV
WAWKEWRVRKIKKYVDRMYSILPFEEEFYARHGYHVDYVGNPSVEEIAYTMGHVPPKKHF
MERQGLVDDRPIIALLPGSRLGEIRNNLPLMVEAAKRFPEFQYVVGAAPSVPEKFYREIA
QDPGLKVVFGATPTLLKYSRAAVVVSGTATLETALIGTPQVVVYRANGSRLSYNIMSHLL
KVKYVSLPNLIVNNSIIPELLLDRCTVDSIARELSPLLQPSPKLTFMTQGYKNMQRRLGN
SVAASTAANLIVDSLRS

Enzyme Prediction     

No EC number prediction in MGYG000000348_01859.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	5	358	1.3e-115	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	5.97e-126	1	377	2	377	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	2.47e-119	1	376	2	380	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	4.55e-86	5	338	3	339	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	8.79e-77	5	371	10	383	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK14089	PRK14089	3.37e-57	1	330	2	309	lipid-A-disaccharide synthase.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36425.1	5.30e-132	1	377	1	376
QQR08529.1	3.86e-123	1	371	1	370
ASB37800.1	3.86e-123	1	371	1	370
ANU64105.1	3.86e-123	1	371	1	370
AHF12800.1	6.79e-123	1	376	1	374

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8S_A	6.49e-40	5	358	11	365	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]
5W8N_A	1.75e-39	5	358	11	365	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q1D393	2.85e-78	2	375	6	378	Lipid-A-disaccharide synthase OS=Myxococcus xanthus (strain DK1622) OX=246197 GN=lpxB PE=3 SV=1
Q2LVL8	3.19e-67	4	368	7	371	Lipid-A-disaccharide synthase OS=Syntrophus aciditrophicus (strain SB) OX=56780 GN=lpxB PE=3 SV=1
Q39T49	1.42e-65	2	375	8	380	Lipid-A-disaccharide synthase OS=Geobacter metallireducens (strain ATCC 53774 / DSM 7210 / GS-15) OX=269799 GN=lpxB PE=3 SV=1
C1F718	2.18e-65	5	367	9	380	Lipid-A-disaccharide synthase OS=Acidobacterium capsulatum (strain ATCC 51196 / DSM 11244 / BCRC 80197 / JCM 7670 / NBRC 15755 / NCIMB 13165 / 161) OX=240015 GN=lpxB PE=3 SV=1
Q0A7J2	1.05e-64	1	371	1	374	Lipid-A-disaccharide synthase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) OX=187272 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000348_01859.