CAZyme Information: MGYG000000349_00427

Basic Information

• Species: CAG-1138 sp000434675
• Lineage: Bacteria; Firmicutes_A; Clostridia_A; Christensenellales; CAG-917; CAG-1138; CAG-1138 sp000434675
• CAZyme ID: MGYG000000349_00427
• CAZy Family: GH2
• CAZyme Description: Beta-galactosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
607	MGYG000000349_2|CGC1	69370.01	6.2903

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000349	1402736	MAG	Sweden	Europe

• Gene Location: Start: 20552; End: 22375 Strand: +

Full Sequence      

MKIMTEWGEKLDRNHPLQEYPRPQMERSSYLNLNGVWNYAITKTMDTPSAYDGEIVVPFA
PECVLSGVEKVVMPDDVLHYEKTFEIPEGFIKDRVLLNFGAVDYKCEVYINGTFCGDHVG
GYNPFSMDVTGKVTEGENRIIVKVTDPTDLGPQARGKQSLKHGGIWYTPSSGIWQTVWME
SVPENYVQKIHFTPDVDNSEIVVKIIAPKQPKNGLITVKFADKVVAEQTYVVGQDTHIAI
SDAKLWSPEEPNLYDVVITLDDDEIKSYFGMRKFSVGKDKNGYDRLMLNNKPYFHNGLLD
QGYWSDGMYTPASDEALAYDVKLAKEMGFNMLRKHIKVEPLRWYYHCDKLGVLVWQDMIN
GGGVYNGVTKLLGGGKYNFFTIGVWPFIHVRLDDKKYGRFSRKDKAGRDEYYKDLEEMVD
ALYNVPSLALWTIFNEGWGQFDSLKVYDFIKKLDPTRTVDPASGWHDQGGKDLLSIHRYW
YPFRIKRNKKGQAVVNWVPGHVTEKLSRPVVLSEYGGYSYQEKGHVFSDKIFGYKVYGNK
EDLNGGLKKLFEGEVEAAMKNGLAAAVYTQLTDVESEINGLVTYDRKVVKIDRNMLKTIN
DRLVIEE

Enzyme Prediction     

No EC number prediction in MGYG000000349_00427.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH2	22	517	4.4e-102	0.5425531914893617

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG3250	LacZ	2.72e-38	16	459	1	429	Beta-galactosidase/beta-glucuronidase [Carbohydrate transport and metabolism].
PRK10150	PRK10150	1.91e-29	20	516	3	510	beta-D-glucuronidase; Provisional
PRK09525	lacZ	1.97e-20	80	459	124	485	beta-galactosidase.
PRK10340	ebgA	3.44e-19	80	459	113	472	cryptic beta-D-galactosidase subunit alpha; Reviewed
pfam02837	Glyco_hydro_2_N	7.89e-17	80	183	69	169	Glycosyl hydrolases family 2, sugar binding domain. This family contains beta-galactosidase, beta-mannosidase and beta-glucuronidase activities and has a jelly-roll fold. The domain binds the sugar moiety during the sugar-hydrolysis reaction.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWB85883.1	1.37e-209	1	603	1	579
ACZ86262.1	7.11e-209	1	606	1	584
AWB95441.1	1.45e-208	3	607	12	603
AWB88178.1	1.58e-207	1	603	1	581
QYC40928.1	4.52e-207	3	605	1	569

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7SF2_A	4.95e-150	2	603	11	582	ChainA, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_B Chain B, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_C Chain C, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_D Chain D, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_E Chain E, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838],7SF2_F Chain F, Glycosyl hydrolase family 2, sugar binding domain protein [Bacteroides cellulosilyticus DSM 14838]
5C70_A	2.27e-29	31	516	21	515	Thestructure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae],5C70_B The structure of Aspergillus oryzae beta-glucuronidase [Aspergillus oryzae]
5C71_A	1.46e-28	31	516	46	540	Thestructure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_B The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_C The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae],5C71_D The structure of Aspergillus oryzae a-glucuronidase complexed with glycyrrhetinic acid monoglucuronide [Aspergillus oryzae]
4JKM_A	3.02e-25	26	516	11	510	CrystalStructure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],4JKM_B Crystal Structure of Clostridium perfringens beta-glucuronidase [Clostridium perfringens str. 13],6CXS_A Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13],6CXS_B Crystal Structure of Clostridium perfringens beta-glucuronidase bound with a novel, potent inhibitor 4-(8-(piperazin-1-yl)-1,2,3,4-tetrahydro-[1,2,3]triazino[4',5':4,5]thieno[2,3-c]isoquinolin-5-yl)morpholine [Clostridium perfringens str. 13]
6D4O_A	3.12e-24	23	587	7	591	Eubacteriumeligens beta-glucuronidase bound to an amoxapine-glucuronide conjugate [Lachnospira eligens]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q03WL0	5.25e-22	99	537	139	547	Beta-galactosidase OS=Leuconostoc mesenteroides subsp. mesenteroides (strain ATCC 8293 / DSM 20343 / BCRC 11652 / CCM 1803 / JCM 6124 / NCDO 523 / NBRC 100496 / NCIMB 8023 / NCTC 12954 / NRRL B-1118 / 37Y) OX=203120 GN=lacZ PE=3 SV=1
B4S2K9	1.62e-21	80	515	124	537	Beta-galactosidase OS=Alteromonas mediterranea (strain DSM 17117 / CIP 110805 / LMG 28347 / Deep ecotype) OX=1774373 GN=lacZ PE=3 SV=1
T2KM09	1.51e-20	80	464	110	459	Putative beta-glucuronidase OS=Formosa agariphila (strain DSM 15362 / KCTC 12365 / LMG 23005 / KMM 3901 / M-2Alg 35-1) OX=1347342 GN=BN863_22050 PE=2 SV=2
Q7MG04	1.51e-20	32	515	49	534	Beta-galactosidase OS=Vibrio vulnificus (strain YJ016) OX=196600 GN=lacZ PE=3 SV=1
Q8D4H3	4.62e-20	32	515	49	535	Beta-galactosidase OS=Vibrio vulnificus (strain CMCP6) OX=216895 GN=lacZ PE=3 SV=2

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000047	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000349_00427.