CAZyme Information: MGYG000000351_00768

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521
• CAZyme ID: MGYG000000351_00768
• CAZy Family: GT19
• CAZyme Description: Lipid-A-disaccharide synthase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
378		42078.12	8.3377

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000351	1843595	MAG	Sweden	Europe

• Gene Location: Start: 49538; End: 50674 Strand: -

Full Sequence      

MAKGLAWLAGETSGDFIASLVLPQVKAQYPDESMFGIGGDRMIAAGLEPWHHSRVLSVRG
YVEVLKKLPSLLRLRSEMKQRVLKAAPRAFIGVDAPDFNLAIEEYLHERGVKTIHFVCPS
IWAWRPERIHTIKRAVDHMLLIFPFEKKLMDDAHIESTYIGHPLAAEIPINPDKAQAREA
LEIDSMGPIFAVMPGSRQAEVAWCGPRFLEACERVLDFDRRAIFLIPAADEARRAQINAL
LTRYPRAQKATRLIEGNSHAVMQASDAVLVASGTATLEAALFKRPMVVGYAMPGLTGLLM
LKKGITPWVSLPNILAGETLVPELLQYYCKPEPLAFALWEAYQKRNDSKLMDRFYAIHES
LLRDTASLAAQAIRGVCG

Enzyme Prediction     

No EC number prediction in MGYG000000351_00768.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT19	7	361	6.8e-116	0.9858757062146892

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK00025	lpxB	1.30e-143	9	373	8	371	lipid-A-disaccharide synthase; Reviewed
COG0763	LpxB	4.60e-123	9	373	8	375	Lipid A disaccharide synthetase [Cell wall/membrane/envelope biogenesis].
pfam02684	LpxB	1.23e-102	9	373	5	374	Lipid-A-disaccharide synthetase. This is a family of lipid-A-disaccharide synthetases, EC:2.4.2.128. These enzymes catalyze the reaction: UDP-2,3-bis(3-hydroxytetradecanoyl) glucosamine + 2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate <=> UDP + 2,3-bis(3-hydroxytetradecanoyl)-D-glucosaminyl-1,6 -beta-D-2,3-bis(3-hydroxytetradecanoyl)-beta-D-glucosaminyl 1-phosphate. These enzymes catalyze the fist disaccharide step in the synthesis of lipid-A-disaccharide.
TIGR00215	lpxB	1.44e-92	4	359	7	360	lipid-A-disaccharide synthase. Lipid-A precursor biosynthesis producing lipid A disaccharide in a condensation reaction. transcribed as part of an operon including lpxA [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK01021	lpxB	8.72e-54	9	338	233	566	lipid-A-disaccharide synthase; Reviewed

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU65980.1	9.15e-153	2	376	6	380
QQQ97139.1	9.15e-153	2	376	6	380
BBF22932.1	1.78e-135	3	373	13	384
QQS88891.1	4.41e-133	3	373	12	384
QDA54177.1	1.49e-131	3	373	13	385

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5W8N_A	1.44e-75	5	373	9	377	LipidA Disaccharide Synthase (LpxB)-6 solubilizing mutations [Escherichia coli BL21(DE3)]
5W8S_A	2.87e-75	5	373	9	377	LipidA Disaccharide Synthase (LpxB)-7 solubilizing mutations [Escherichia coli BL21(DE3)],5W8X_A Lipid A Disaccharide Synthase (LpxB)-7 solubilizing mutations-Bound to UDP [Escherichia coli BL21(DE3)]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
B2JIB3	5.32e-114	5	376	10	381	Lipid-A-disaccharide synthase OS=Paraburkholderia phymatum (strain DSM 17167 / CIP 108236 / LMG 21445 / STM815) OX=391038 GN=lpxB PE=3 SV=1
A4JF62	9.03e-110	5	373	10	378	Lipid-A-disaccharide synthase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) OX=269482 GN=lpxB PE=3 SV=1
Q39F56	1.28e-109	5	373	10	378	Lipid-A-disaccharide synthase OS=Burkholderia lata (strain ATCC 17760 / DSM 23089 / LMG 22485 / NCIMB 9086 / R18194 / 383) OX=482957 GN=lpxB PE=3 SV=1
Q2L147	1.00e-107	1	373	1	387	Lipid-A-disaccharide synthase OS=Bordetella avium (strain 197N) OX=360910 GN=lpxB PE=3 SV=1
A1V555	1.61e-107	5	376	10	381	Lipid-A-disaccharide synthase OS=Burkholderia mallei (strain SAVP1) OX=320388 GN=lpxB PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000066	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000351_00768.