CAZyme Information: MGYG000000351_00846

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521
• CAZyme ID: MGYG000000351_00846
• CAZy Family: GT9
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
312	MGYG000000351_5|CGC2	34098.63	8.1073

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000351	1843595	MAG	Sweden	Europe

• Gene Location: Start: 29828; End: 30766 Strand: +

Full Sequence      

MKPIVICRLPNHVGDCCMTLPALRLLDASGFTPYLVGKRFAEDLMLGMGWRFDPIEGHVT
EDLSRLHYLSEQQHKPLGILFPNSFGSALQFKLAGIRSAGFATDGRFLLLDQKIPEPAKN
VHEVERFFAVAKGAVKAWGATPAWAEPPKELGLQLIARHTAGAKNLKEKFNIPEKFALIA
PIARGVHHGKIKHWVHINSVVKPLKDMGIEPIVMPSPDEVEEAKIACPDARHLPPTNLGT
YAALCKEASVVIANDSGVSHVAAAVGAKQITLVGVTDPHRTGPWNPNAVVIGSERGWPSE
DEVIQKLQEMLR

Enzyme Prediction     

No EC number prediction in MGYG000000351_00846.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT9	79	293	2.4e-28	0.8355555555555556

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam01075	Glyco_transf_9	1.56e-31	77	296	15	232	Glycosyltransferase family 9 (heptosyltransferase). Members of this family belong to glycosyltransferase family 9. Lipopolysaccharide is a major component of the outer leaflet of the outer membrane in Gram-negative bacteria. It is composed of three domains; lipid A, Core oligosaccharide and the O-antigen. All of these enzymes transfer heptose to the lipopolysaccharide core.
cd03789	GT9_LPS_heptosyltransferase	2.65e-20	3	301	1	250	lipopolysaccharide heptosyltransferase and similar proteins. Lipopolysaccharide heptosyltransferase (2.4.99.B6) is involved in the biosynthesis of lipooligosaccharide (LOS). Lipopolysaccharide (LPS) is a major component of the outer membrane of gram-negative bacteria. LPS heptosyltransferase transfers heptose molecules from ADP-heptose to 3-deoxy-D-manno-octulosonic acid (KDO), a part of the inner core component of LPS. This family also contains lipopolysaccharide 1,2-N-acetylglucosaminetransferase EC 2.4.1.56 and belongs to the GT-B structural superfamily of glycoslytransferases, which have characteristic N- and C-terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility.
COG0859	RfaF	3.40e-20	1	291	1	295	ADP-heptose:LPS heptosyltransferase [Cell wall/membrane/envelope biogenesis].
TIGR02195	heptsyl_trn_II	9.94e-11	79	291	84	295	lipopolysaccharide heptosyltransferase II. This family consists of examples of ADP-heptose:LPS heptosyltransferase II, an enzyme of LPS inner core region biosynthesis. LPS, composed of lipid A, a core region, and O antigen, is found in the outer membrane of Gram-negative bacteria. [Cell envelope, Biosynthesis and degradation of surface polysaccharides and lipopolysaccharides]
PRK10964	PRK10964	1.12e-05	192	311	192	320	lipopolysaccharide heptosyltransferase RfaC.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QQS89241.1	5.11e-138	5	311	6	313
BBF22597.1	7.31e-137	1	311	1	311
QDA55160.1	1.00e-136	5	310	4	309
ANU65198.1	3.10e-112	8	311	7	309
QQQ96353.1	3.10e-112	8	311	7	309

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
1PSW_A	3.49e-06	67	291	74	305	Structureof E. coli ADP-heptose lps heptosyltransferase II [Escherichia coli]

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000056	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000351_00846.