CAZyme Information: MGYG000000351_01618

Basic Information

• Lineage: Bacteria; Proteobacteria; Gammaproteobacteria; Burkholderiales; Burkholderiaceae; CAG-521
• CAZyme ID: MGYG000000351_01618
• CAZy Family: GH8
• CAZyme Description: Endoglucanase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
368	MGYG000000351_23|CGC1	41417.81	4.4948

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000351	1843595	MAG	Sweden	Europe

• Gene Location: Start: 5579; End: 6685 Strand: -

Full Sequence      

MKHWILALAMGCSMIAPAFAWDLWEDFKGVGIENGRVVDYSDDRAVTTSEGQSYGMFFAL
VDGDKESFASLLKWTEDNLSSGDITKELPSWLWGRSGSNWIILDTNNAVDSDMWIAYCLL
EAGRLWNDPSYTQKGQKMLELLKEQVRDVDNLGKVLLPGRVGFDKGDSVKLNPSYYPLFI
LKRFALEDSYWNEVFDGSLRVLLRSAPAGISPDWATFSKNGELLPVDDIDNTIGSYNSIR
VYLWAGMMSPRDPSYKTLREHFAPMVALTEKLNMPPEKVNVNTLEVNQAAGDGFGACLLE
YLGESKTADFIRTVLENTPIEKNNYYRNVLALYGLGFDQGLFAFDRDGRLYFPKAQQTQA
QSKESQSS

Enzyme Prediction     

No EC number prediction in MGYG000000351_01618.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH8	21	337	6.3e-75	0.99375

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
PRK11097	PRK11097	1.27e-146	1	350	4	364	cellulase.
COG3405	BcsZ	6.36e-77	1	357	5	357	Endo-1,4-beta-D-glucanase Y [Carbohydrate transport and metabolism].
pfam01270	Glyco_hydro_8	4.11e-59	20	340	3	321	Glycosyl hydrolases family 8.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDA53874.1	7.87e-157	5	350	9	358
QQS88762.1	1.46e-152	1	354	5	363
ANU67169.1	2.75e-125	2	358	3	356
QQQ96024.1	2.75e-125	2	358	3	356
QDA53782.1	7.34e-106	15	354	58	411

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4Q2B_A	2.49e-97	20	350	3	339	Thecrystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_B The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_C The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_D The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_E The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440],4Q2B_F The crystal structure of an endo-1,4-D-glucanase from Pseudomonas putida KT2440 [Pseudomonas putida KT2440]
5CD2_A	1.57e-87	21	348	26	361	Thecrystal structure of endo-1,4-D-glucanase from Vibrio fischeri ES114 [Aliivibrio fischeri ES114]
3QXQ_A	8.41e-86	18	350	1	335	Structureof the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_B Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_C Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12],3QXQ_D Structure of the bacterial cellulose synthase subunit Z in complex with cellopentaose [Escherichia coli K-12]
7F81_A	3.35e-84	18	350	5	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F81_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F81_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F81_D Chain D, Glucanase [Enterobacter sp. CJF-002]
7F82_A	9.47e-84	18	350	5	339	ChainA, Glucanase [Enterobacter sp. CJF-002],7F82_B Chain B, Glucanase [Enterobacter sp. CJF-002],7F82_C Chain C, Glucanase [Enterobacter sp. CJF-002],7F82_D Chain D, Glucanase [Enterobacter sp. CJF-002]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q8ZLB7	9.82e-88	1	350	5	357	Endoglucanase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=bcsZ PE=3 SV=1
Q8X5L9	1.90e-87	5	350	9	356	Endoglucanase OS=Escherichia coli O157:H7 OX=83334 GN=bcsZ PE=3 SV=1
Q8Z289	2.22e-86	1	350	5	357	Endoglucanase OS=Salmonella typhi OX=90370 GN=bcsZ PE=3 SV=1
P37651	3.04e-86	5	350	9	356	Endoglucanase OS=Escherichia coli (strain K12) OX=83333 GN=bcsZ PE=1 SV=1
P58935	3.06e-75	5	350	15	371	Endoglucanase OS=Xanthomonas axonopodis pv. citri (strain 306) OX=190486 GN=bcsZ PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000758	0.976065	0.022402	0.000259	0.000247	0.000234

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000351_01618.