CAZyme Information: MGYG000000352_00301

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UBA1740
• CAZyme ID: MGYG000000352_00301
• CAZy Family: GH31
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
504		56744.3	4.575

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000352	1338316	MAG	Sweden	Europe

• Gene Location: Start: 21546; End: 23060 Strand: +

Full Sequence      

MKINYLPDEHFFGGAVNDGIFMPYSCGFSRDLRVWHAGNQATSALLSDRGRLVYSDRPFL
YDFGEDGITAEGENIAVEQCGDTLKDAYLTMRDHLADKTCVGQMPPSDMFTVPQYNTWIE
MEWDCTQEKVLRYAQEILAHGYPAGVLMIDDCWCRAYGDWEFDTARFPDPKGLVNELHDM
GFRVMLWCCPFVSPDTAVFRRLEADGALVRTADGQTAISHWWNGYSAVLDLTVPAATRWF
DEQADRLMAAYGIDGFKMDAADPEYYPDGFVFSDGSQRSFQAKKWAEIGAKYAYNELRAG
FNAGWLPVANRLRDKNHSWTADGLNTLVPDGLAMGLCGYQYLCPDMIGGGMVPDFHRAGF
VFDSELFVRYCQVAAAFPMMQFSRAPWKVLGEAEQRLCLEAVALHTRMADTIVRLAEDCA
ATGEPMLRSLEYVFPHRGYAAVSDEFLLGNDILVAPQLQKGVQYRRVILPDGLWADENGR
IYTGGTYTIETPLSRLPVFTRKDI

Enzyme Prediction     

No EC number prediction in MGYG000000352_00301.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH31	103	502	1.2e-79	0.9344262295081968

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd06592	GH31_NET37	4.29e-150	111	474	1	364	glucosidase NET37. NET37 (also known as KIAA1161) is a human lamina-associated nuclear envelope transmembrane protein. A member of the glycosyl hydrolase family 31 (GH31) , it has been shown to be required for myogenic differentiation of C2C12 cells. Related proteins are found in eukaryotes and prokaryotes. Enzymes of the GH31 family possess a wide range of different hydrolytic activities including alpha-glucosidase (glucoamylase and sucrase-isomaltase), alpha-xylosidase, 6-alpha-glucosyltransferase, 3-alpha-isomaltosyltransferase and alpha-1,4-glucan lyase. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
COG1501	YicI	6.28e-67	46	501	198	665	Alpha-glucosidase, glycosyl hydrolase family GH31 [Carbohydrate transport and metabolism].
PRK10426	PRK10426	9.45e-44	128	503	221	620	alpha-glucosidase; Provisional
cd06597	GH31_transferase_CtsY	1.40e-36	122	382	19	287	CtsY (cyclic tetrasaccharide-synthesizing enzyme Y)-like. CtsY is a bacterial 3-alpha-isomaltosyltransferase, first identified in Arthrobacter globiformis, that produces cyclic tetrasaccharides together with a closely related enzyme CtsZ. CtsY and CtsZ both have a glycosyl hydrolase family 31 (GH31) catalytic domain; CtsZ belongs to a different subfamily. All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein.
cd06593	GH31_xylosidase_YicI	2.64e-33	126	387	22	288	alpha-xylosidase YicI-like. YicI alpha-xylosidase is a glycosyl hydrolase family 31 (GH31) enzyme that catalyzes the release of an alpha-xylosyl residue from the non-reducing end of alpha-xyloside substrates such as alpha-xylosyl fluoride and isoprimeverose. YicI forms a homohexamer (a trimer of dimers). All GH31 enzymes cleave a terminal carbohydrate moiety from a substrate that varies considerably in size, depending on the enzyme, and may be either a starch or a glycoprotein. The YicI family corresponds to subgroup 4 in the Ernst et al classification of GH31 enzymes.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AIQ45863.1	4.36e-169	3	501	8	506
QHT59803.1	4.33e-167	1	502	6	509
AIQ51502.1	1.27e-166	3	501	11	509
AEI41761.1	1.63e-166	1	502	6	507
ASS65358.1	5.49e-165	6	501	11	507

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5F7U_A	5.60e-29	156	501	426	797	Cycloalternan-formingenzyme from Listeria monocytogenes in complex with pentasaccharide substrate [Listeria monocytogenes EGD-e]
5F7S_A	3.17e-28	122	485	303	711	Cycloalternan-degradingenzyme from Trueperella pyogenes [Trueperella pyogenes],5F7S_B Cycloalternan-degrading enzyme from Trueperella pyogenes [Trueperella pyogenes],5I0E_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with isomaltose [Trueperella pyogenes],5I0F_B Cycloalternan-degrading enzyme from Trueperella pyogenes in complex with covalent intermediate [Trueperella pyogenes]
5I0G_B	3.26e-27	122	485	303	711	Cycloalternan-degradingenzyme from Trueperella pyogenes in complex with cycloalternan [Trueperella pyogenes]
5F7C_A	8.14e-27	81	503	287	712	Crystalstructure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_B Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_C Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482],5F7C_D Crystal structure of Family 31 alpha-glucosidase (BT_0339) from Bacteroides thetaiotaomicron [Bacteroides thetaiotaomicron VPI-5482]
5AED_A	4.10e-26	155	503	301	665	Abacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AED_B A bacterial protein structure in glycoside hydrolase family 31 [Escherichia coli K-12],5AEG_A A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5AEG_B A bacterial protein structure in glycoside hydrolase family 31. [Escherichia coli K-12],5OHT_A A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12],5OHT_B A GH31 family sulfoquinovosidase from E. coli in complex with aza-sugar inhibitor IFGSQ [Escherichia coli K-12]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q6NSJ0	1.75e-67	102	482	305	690	Myogenesis-regulating glycosidase OS=Homo sapiens OX=9606 GN=MYORG PE=1 SV=2
Q69ZQ1	1.81e-65	102	482	304	692	Myogenesis-regulating glycosidase OS=Mus musculus OX=10090 GN=Myorg PE=1 SV=2
P19965	7.17e-26	183	502	350	681	SITS-binding protein OS=Tetronarce californica OX=7787 PE=1 SV=2
P32138	2.21e-25	155	503	301	665	Sulfoquinovosidase OS=Escherichia coli (strain K12) OX=83333 GN=yihQ PE=1 SV=3
D2PPM7	1.82e-24	165	501	350	711	1,3-alpha-isomaltosidase OS=Kribbella flavida (strain DSM 17836 / JCM 10339 / NBRC 14399) OX=479435 GN=Kfla_1895 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000041	0.000001	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000352_00301.