CAZyme Information: MGYG000000352_00509

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UBA1740
• CAZyme ID: MGYG000000352_00509
• CAZy Family: GH109
• CAZyme Description: Alpha-N-acetylgalactosaminidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
409	MGYG000000352_21|CGC1	45847.94	4.9812

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000352	1338316	MAG	Sweden	Europe

• Gene Location: Start: 15465; End: 16694 Strand: -

Full Sequence      

MDKVRIGMVGLGQRGSVLLRTLLAIEDAEIVAVCDVYEDRRRAAVGTVEEKRAHTPRAYE
NYRELLGDPAVDLVFICSSWEVHIRQAIESMRAGKVTAVEVGGAYTLDECWDLVDAYEET
GTPVMMLENCCYDRFELLSTALVRRGMLGEVVHCHGAYSHDLREEILGGNVHRHYRLRNY
LTRNCENYPTHEIGPIARLLGINRGNRMTRLVSVASKARGLEAFATSDKNPDPTLVGTKF
AQGDIVSTIITCEGGETITLTLDTALPKYYSREFTVRGTKGLTNQEANMVLIESEHTDMH
DTSVTSETLRKYLDNADGYAAYLPDFWRNITDEARALGHGGMDYYMCSELIRCVREGREM
PIDVYDAAAWASITPLSEISIRTGEAVEIPDFTRGKYRERPLEDVVSLV

Enzyme Prediction     

No EC number prediction in MGYG000000352_00509.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH109	1	399	3.8e-140	0.9899749373433584

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG0673	MviM	2.79e-27	1	391	1	342	Predicted dehydrogenase [General function prediction only].
pfam01408	GFO_IDH_MocA	1.64e-12	4	126	1	118	Oxidoreductase family, NAD-binding Rossmann fold. This family of enzymes utilize NADP or NAD. This family is called the GFO/IDH/MOCA family in swiss-prot.
PRK10206	PRK10206	2.65e-05	64	152	58	146	putative oxidoreductase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALS29040.1	2.80e-137	2	400	3	398
QTH43530.1	4.92e-137	2	400	3	398
QTH41319.1	6.02e-137	2	400	6	401
QUO31207.1	1.09e-130	1	400	1	398
QJD87109.1	2.18e-130	2	397	3	394

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
2IXA_A	5.62e-88	3	398	20	432	A-zyme,N-acetylgalactosaminidase [Elizabethkingia meningoseptica],2IXB_A Crystal structure of N-ACETYLGALACTOSAMINIDASE in complex with GalNAC [Elizabethkingia meningoseptica]
6T2B_A	3.23e-64	1	408	40	449	Glycosidehydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_B Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_C Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila],6T2B_D Glycoside hydrolase family 109 from Akkermansia muciniphila in complex with GalNAc and NAD+. [Akkermansia muciniphila]
3EC7_A	1.43e-12	4	158	24	176	CrystalStructure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_B Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_C Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_D Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_E Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_F Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_G Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2],3EC7_H Crystal Structure of Putative Dehydrogenase from Salmonella typhimurium LT2 [Salmonella enterica subsp. enterica serovar Typhimurium str. LT2]
3EZY_A	7.81e-11	4	150	3	144	Crystalstructure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_B Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_C Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima],3EZY_D Crystal structure of probable dehydrogenase TM_0414 from Thermotoga maritima [Thermotoga maritima]
6JW6_A	9.27e-09	4	115	5	111	Thecrystal structure of KanD2 in complex with NAD [Streptomyces kanamyceticus],6JW6_B The crystal structure of KanD2 in complex with NAD [Streptomyces kanamyceticus],6JW7_A The crystal structure of KanD2 in complex with NADH and 3'-deamino-3'-hydroxykanamycin A [Streptomyces kanamyceticus],6JW7_B The crystal structure of KanD2 in complex with NADH and 3'-deamino-3'-hydroxykanamycin A [Streptomyces kanamyceticus],6JW8_A The crystal structure of KanD2 in complex with NADH and 3'-deamino-3'-hydroxykanamycin B [Streptomyces kanamyceticus],6JW8_B The crystal structure of KanD2 in complex with NADH and 3'-deamino-3'-hydroxykanamycin B [Streptomyces kanamyceticus]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A4Q8F7	3.08e-87	3	398	20	432	Alpha-N-acetylgalactosaminidase OS=Elizabethkingia meningoseptica OX=238 GN=nagA PE=1 SV=1
B2FLK4	1.01e-84	3	400	33	444	Glycosyl hydrolase family 109 protein OS=Stenotrophomonas maltophilia (strain K279a) OX=522373 GN=Smlt4431 PE=3 SV=1
A4Q8G1	6.48e-83	4	400	53	462	Alpha-N-acetylgalactosaminidase OS=Tannerella forsythia OX=28112 GN=nagA PE=3 SV=1
A6LB54	6.78e-82	3	400	49	460	Glycosyl hydrolase family 109 protein OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / CIP 104284 / JCM 5825 / NCTC 11152) OX=435591 GN=BDI_1155 PE=3 SV=1
A6KY05	1.83e-77	4	400	17	413	Glycosyl hydrolase family 109 protein 2 OS=Phocaeicola vulgatus (strain ATCC 8482 / DSM 1447 / JCM 5826 / CCUG 4940 / NBRC 14291 / NCTC 11154) OX=435590 GN=BVU_0611 PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000038	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000352_00509.