CAZyme Information: MGYG000000352_00706

Basic Information

• Lineage: Bacteria; Firmicutes_A; Clostridia; Oscillospirales; CAG-272; UBA1740
• CAZyme ID: MGYG000000352_00706
• CAZy Family: GH3
• CAZyme Description: Beta-N-acetylglucosaminidase/beta-glucosidase

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
572	MGYG000000352_36|CGC1	62323.26	5.4442

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000352	1338316	MAG	Sweden	Europe

• Gene Location: Start: 7192; End: 8910 Strand: -

Full Sequence      

MLNYELLKKPPFSLDDASLAWVRETLSGMSEDEKIGQLFHLVTYTSDEEALRALCETYMP
GGMMARTLPLDEACRVSNALQRYSKIPMLISANFEAGGDGMVAEGTNVGPNMMIAATGDP
ENARRQGEVAAAEGTAVGANYAFAPVIDIDYNFRNPITNTRTYGGDPAFVAAAGEAFTRA
VQAKGMAVSVKHFPGDGCDERDQHLVTSINSLSTEEWDRTYGEAYRRSIEAGALTVMVGH
IMQPAYSRALVPGIRDEDILPATLAPELLGGLLRGKLGFNGMIITDSSTMAGMCVPMDRR
VAVPRAIAAGCDMFLFTKNIDEDYGYMKAGLTNGILTRERLDEAVMRILGVKAALRLPEK
RADGSIFVSPEKAREVVGCKAHREIEREVTDAGVTLVKNKENLLPISPEKHRRVLLIGLR
GGENAFGTGGGEDIEGVTAEALRKEGFEVTVFRPAKGFEGLMTPYADVVDRYDLILYVSN
LATKSNQTTVRIEWASPMGANCPSYLSVVPTVFVSFANPYHLLDVPRVKTFVNAYRFKDA
TVRAVIDKLLGRSAFRGVSPVDAYCGKWDTHL

Enzyme Prediction     

No EC number prediction in MGYG000000352_00706.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH3	82	315	9.6e-50	0.9722222222222222

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
COG1472	BglX	1.01e-50	29	418	1	361	Periplasmic beta-glucosidase and related glycosidases [Carbohydrate transport and metabolism].
pfam00933	Glyco_hydro_3	2.99e-49	32	351	3	316	Glycosyl hydrolase family 3 N terminal domain.
PRK05337	PRK05337	2.59e-19	118	315	90	278	beta-hexosaminidase; Provisional
PRK15098	PRK15098	9.17e-19	2	418	19	417	beta-glucosidase BglX.
PLN03080	PLN03080	6.34e-04	143	431	154	439	Probable beta-xylosidase; Provisional

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
BCJ98177.1	5.01e-275	1	572	1	572
BCJ96305.1	3.66e-270	1	572	1	572
QHQ60267.1	2.67e-265	1	572	1	572
AEF56853.1	1.17e-247	1	572	24	593
AEI40672.1	2.24e-230	7	572	8	571

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5VQD_A	2.93e-155	6	572	5	567	Beta-glucosidephosphorylase BglX [unidentified],5VQE_A Beta-glucoside phosphorylase BglX bound to 2FGlc [unidentified]
3BMX_A	5.28e-50	24	562	37	616	Beta-N-hexosaminidase(YbbD) from Bacillus subtilis [Bacillus subtilis],3BMX_B Beta-N-hexosaminidase (YbbD) from Bacillus subtilis [Bacillus subtilis],3NVD_A Structure of YBBD in complex with pugnac [Bacillus subtilis],3NVD_B Structure of YBBD in complex with pugnac [Bacillus subtilis]
3LK6_A	1.81e-49	24	562	11	590	ChainA, Lipoprotein ybbD [Bacillus subtilis],3LK6_B Chain B, Lipoprotein ybbD [Bacillus subtilis],3LK6_C Chain C, Lipoprotein ybbD [Bacillus subtilis],3LK6_D Chain D, Lipoprotein ybbD [Bacillus subtilis]
4GYJ_A	2.79e-49	24	562	41	620	Crystalstructure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYJ_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1) [Bacillus subtilis subsp. subtilis str. 168],4GYK_A Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168],4GYK_B Crystal structure of mutant (D318N) bacillus subtilis family 3 glycoside hydrolase (nagz) in complex with glcnac-murnac (space group P1211) [Bacillus subtilis subsp. subtilis str. 168]
6K5J_A	1.75e-40	33	560	15	528	Structureof a glycoside hydrolase family 3 beta-N-acetylglucosaminidase from Paenibacillus sp. str. FPU-7 [Paenibacillaceae]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q7WUL3	8.10e-210	7	572	4	564	Beta-N-acetylglucosaminidase/beta-glucosidase OS=Cellulomonas fimi OX=1708 GN=nag3 PE=1 SV=1
P40406	2.89e-49	24	562	37	616	Beta-hexosaminidase OS=Bacillus subtilis (strain 168) OX=224308 GN=nagZ PE=1 SV=1
P48823	6.83e-28	65	406	78	425	Beta-hexosaminidase A OS=Pseudoalteromonas piscicida OX=43662 GN=cht60 PE=1 SV=1
B7UYS5	6.75e-24	61	315	28	273	Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain LESB58) OX=557722 GN=nagZ PE=3 SV=1
Q9HZK0	6.75e-24	61	315	28	273	Beta-hexosaminidase OS=Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) OX=208964 GN=nagZ PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000063	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000352_00706.