CAZyme Information: MGYG000000353_01335

Basic Information

• Species: UBA7173 sp900548705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900548705
• CAZyme ID: MGYG000000353_01335
• CAZy Family: GH66
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
680	MGYG000000353_10|CGC1	77318.32	5.0839

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000353	2738445	MAG	Sweden	Europe

• Gene Location: Start: 47973; End: 50015 Strand: -

Full Sequence      

MIDKKMLLSGLGLILCCGIAAGQGRSGVWVGTSATSGEFPPANSVAMSQSPVGDFHTGIT
AVGEDDKISFADYGDGEATPSRIAPLGHKDFPSSENWAYDIQDGTDIHGYPARQIVTGKP
DINKFDLWTDRACYRPGETVWIQAAKFAEYPNAIIRYRHGTVVLKEEPLKQEWWPWTPPT
TDFRGYLVDVYRLDENGHEEILGSIGVDVSSTWTRYPRNGYTAWFEPGKEHYIGGDVAFL
NRRHINVVQFQDWHWKHHHPYCGDAEYTDIANNKVSLNVVKEFISSQHGYNMKSLFYNLG
FGALERADAAKDGVKEEWYYYFDANHTSKDYHDLPDSWKSDITFVDPGNTEWQNYLCDRN
DEVYRNLDFDGFQVDQVGKRGDGYIYDYWGNRHLLADRFPSLLQAFKNRHPSKSLIMNSV
SKHGANQIASSGVVDACYSELWDNEASFMDLYWVIFDNKKASGNDDMKTIFACYMNYDFA
DKNPGKPFNNPGVLLTDACMFALGAFHLELGTGGNMLGREYFPNTNLHMDDELKGDITRY
YDFITAYENYIYDTSRELTPNITSLSGHQLSIWNYALGPQPRKVVVHAKETKEGAMVFHL
LNFKSTNSLSWRDLKADMPRPERQTDISLDIDCDKMVSRVWVATPDGDACVPRSLEFTQQ
GRSVRVTVPSLDYWTMLVLE

Enzyme Prediction     

No EC number prediction in MGYG000000353_01335.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH66	126	679	9.9e-155	0.9928057553956835

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam13199	Glyco_hydro_66	0.0	129	678	1	557	Glycosyl hydrolase family 66. This family is a set of glycosyl hydrolase enzymes including cycloisomaltooligosaccharide glucanotransferase (EC:2.4.1.-) and dextranase (EC:3.2.1.11) activities.
cd14745	GH66	1.11e-141	215	547	1	331	Glycoside Hydrolase Family 66. Glycoside Hydrolase Family 66 contains proteins characterized as cycloisomaltooligosaccharide glucanotransferase (CITase) and dextranases from a variety of bacteria. CITase cyclizes part of a (1-6)-alpha-D-glucan (dextrans) chain by formation of a (1-6)-alpha-D-glucosidic bond. Dextranases catalyze the endohydrolysis of (1-6)-alpha-D-glucosidic linkages in dextran. Some members contain Carbohydrate Binding Module 35 (CBM35) domains, either C-terminal or inserted in the domain or both.
COG2373	YfaS	2.88e-04	124	237	395	488	Uncharacterized conserved protein YfaS, alpha-2-macroglobulin family [General function prediction only].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QDO70249.1	2.56e-184	126	680	50	596
ALJ62514.1	3.62e-184	126	680	50	596
QUT91748.1	1.45e-183	126	680	50	596
QUT36786.1	3.56e-180	126	680	50	601
QUT99422.1	4.72e-180	126	680	48	599

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5AXG_A	2.76e-88	126	680	46	609	Crystalstructure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus [Thermoanaerobacter pseudethanolicus ATCC 33223],5AXG_B Crystal structure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus [Thermoanaerobacter pseudethanolicus ATCC 33223]
5AXH_A	2.89e-87	126	680	46	609	Crystalstructure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus, D312G mutant in complex with isomaltohexaose [Thermoanaerobacter pseudethanolicus ATCC 33223],5AXH_B Crystal structure of thermophilic dextranase from Thermoanaerobacter pseudethanolicus, D312G mutant in complex with isomaltohexaose [Thermoanaerobacter pseudethanolicus ATCC 33223]
5X7G_A	1.77e-50	127	679	29	720	CrystalStructure of Paenibacillus sp. 598K cycloisomaltooligosaccharide glucanotransferase [Paenibacillus sp. 598K],5X7H_A Crystal Structure of Paenibacillus sp. 598K cycloisomaltooligosaccharide glucanotransferase complexed with cycloisomaltoheptaose [Paenibacillus sp. 598K]
3WNK_A	3.37e-48	111	679	16	721	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNP_A	2.59e-47	127	679	11	702	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNP_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94286	1.02e-47	111	680	33	739	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 PE=1 SV=1
P70873	1.42e-46	127	680	39	731	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 GN=cit PE=3 SV=1
P39653	1.35e-27	113	680	152	801	Dextranase OS=Streptococcus downei OX=1317 GN=dex PE=1 SV=1
Q59979	1.25e-23	181	680	42	598	Dextranase OS=Streptococcus salivarius OX=1304 GN=dex PE=3 SV=1
Q54443	2.11e-22	123	680	104	733	Dextranase OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) OX=210007 GN=dexA PE=1 SV=2

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.004793	0.665616	0.328547	0.000418	0.000300	0.000305

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000353_01335.