CAZyme Information: MGYG000000353_01990

Basic Information

• Species: UBA7173 sp900548705
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; UBA7173; UBA7173 sp900548705
• CAZyme ID: MGYG000000353_01990
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
799	MGYG000000353_24|CGC1	89054.24	6.2155

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000353	2738445	MAG	Sweden	Europe

• Gene Location: Start: 36719; End: 39118 Strand: +

Full Sequence      

MLHKSGTTNYLRISASLLTRLSVAVALLAAFPGDMAAKKKKNAPQVEVTPEITAMDGVIL
ETPAYRWVGDTIFQGPFKAYAPDDTTIISDYSAAPGYFMPIEKEWHLKNDISSYPRLSTS
NTLHNAIFNMGLDEMVNAVEPDSTLRTGKEWPGVWTRDVSYSIILSMAMLQPEVSRISLE
HKISPNGTIIQDTGSGGAWPVSSDRQIWGIAAFEVYKATGDLNWLRRAYPIMKKSLEDDY
ATIYDRETGLVRGETSFIDWREQSYPRWMQTADIYQSEALGTSVVHAQAWKTLAEMATIL
GHNADARTYAARAEKMAQAINDELWLNDKGYYGMYLYGRGNLIMNPRAETLGESLAILYD
VASPERAKLITEKNPVTPFGPAIFIPQIADMPAYHNNALWPFVASYWTLANAKAANSRGV
MLGLGSVFRPAALFATNKENFNLDNGDITTELNSSNMLWSLSGNLALTMKMLFGITPETD
GISFKPFIPKQLDDHRLLTGLRYRDMVLNISIEGYGNRISKFFLNGKAHLPFIPADLKGE
QEIKIVMDNNVPQPIKVNETANVKAPLTPIAWLTYDSSVPGRENTPRLNLLQWQPIEYID
HYVILRDGNRIAITNETTWNAAEPGEYQVIGVDANGVESFASEPRSNRPVIAVEMPVETT
RITSSEACNLPLAPLKGYRGTGFAEIDHTTLPIHIGVDIKEAGTYSLDFRYANGNGPVNT
QNKCAIRTVLVDNNRLGTVVFPQRGVGNWNDWSHTNSLQVHLTPGRHVITLKYLPENENM
NFSTNHALVDRLLLRRINP

Enzyme Prediction     

No EC number prediction in MGYG000000353_01990.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam17389	Bac_rhamnosid6H	1.11e-16	188	333	71	222	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
cd04083	CBM35_Lmo2446-like	8.86e-16	677	773	22	110	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
COG3408	GDB1	4.51e-09	151	511	281	641	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
cd04082	CBM35_pectate_lyase-like	2.10e-08	677	771	21	108	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
cd04080	CBM6_cellulase-like	3.04e-08	697	771	63	129	Carbohydrate Binding Module 6 (CBM6); appended to glycoside hydrolase (GH) domains, including GH5 (cellulase). This family includes carbohydrate binding module 6 (CBM6) domains that are appended to several glycoside hydrolase (GH) domains, including GH5 (cellulase) and GH16, as well as to coagulation factor 5/8 carbohydrate-binding domains. CBM6s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. The CBM6s are appended to GHs that display a diversity of substrate specificities. For some members of this family information is available about the specific substrates of the appended GH domains. It includes the CBM domains of various enzymes involved in cell wall degradation including, an extracellular beta-1,3-glucanase from Lysobacter enzymogenes encoded by the gluC gene (its catalytic domain belongs to the GH16 family), the tandem CBM domains of Pseudomonas sp. PE2 beta-1,3(4)-glucanase A (its catalytic domain also belongs to GH16), and a family 6 CBM from Cellvibrio mixtus Endoglucanase 5A (CmCBM6) which binds to the beta1,4-beta1,3-mixed linked glucans lichenan, and barley beta-glucan, cello-oligosaccharides, insoluble forms of cellulose, the beta1,3-glucan laminarin, and xylooligosaccharides, and the CBM6 of Fibrobacter succinogenes S85 XynD xylanase, appended to a GH10 domain, and Cellvibrio japonicas Cel5G appended to a GH5 (cellulase) domain. GH5 (cellulase) family includes enzymes with several known activities such as endoglucanase, beta-mannanase, and xylanase, which are involved in the degradation of cellulose and xylans. GH16 family includes enzymes with lichenase, xyloglucan endotransglycosylase (XET), and beta-agarase activities. CBM6 is an unusual CBM as it represents a chimera of two distinct binding sites with different modes of binding: binding site I within the loop regions and binding site II on the concave face of the beta-sandwich fold. For CmCBM6 it has been shown that these two binding sites have different ligand specificities.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AWG27199.1	1.35e-230	102	797	212	893
QNK61875.1	1.52e-228	105	792	216	886
AKQ46615.1	7.59e-227	105	797	228	905
QTE38578.1	9.74e-227	84	797	196	889
QEC58493.1	3.53e-225	105	798	199	878

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5X7G_A	2.32e-07	677	773	423	512	CrystalStructure of Paenibacillus sp. 598K cycloisomaltooligosaccharide glucanotransferase [Paenibacillus sp. 598K],5X7H_A Crystal Structure of Paenibacillus sp. 598K cycloisomaltooligosaccharide glucanotransferase complexed with cycloisomaltoheptaose [Paenibacillus sp. 598K]
3WNL_A	5.25e-07	677	773	405	494	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNM_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNN_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_A Chain A, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNO_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNK_A	5.28e-07	677	773	424	513	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]
3WNP_A	1.19e-06	677	773	405	494	ChainA, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans],3WNP_B Chain B, Cycloisomaltooligosaccharide glucanotransferase [Niallia circulans]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
P94286	3.20e-06	677	773	441	530	Cycloisomaltooligosaccharide glucanotransferase OS=Niallia circulans OX=1397 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.129946	0.820769	0.046806	0.001634	0.000438	0.000379

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000353_01990.