CAZyme Information: MGYG000000354_00437

Basic Information

• Species: CAG-485 sp001701295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp001701295
• CAZyme ID: MGYG000000354_00437
• CAZy Family: GT3
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
557		62415.46	5.6141

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000354	2905675	MAG	Sweden	Europe

• Gene Location: Start: 128528; End: 130201 Strand: +

Full Sequence      

MDTSKASDIANRIALLVETSWEVCNKVGGIYAVLSTKARVLNEEFGEKLAFIGPDIWTAD
NPSPYFKERKTLFKSASSKLDLPWGITIRTGRWNIPGSPQVILVNPGDTASHLPAIYGEM
WERYGVDSLHAYGDYDESCAFSVASAIVIMRLAEFLKIDPARVMAHFDEWTTGMGLLWLK
AHSPESSTLFTTHATSIGRSICGNGKPLYDQFHHYDGDQMAHELNMESKHSLEKQAAHNA
DCFTTVSKVTAAECSQLLRRPVDVVTPNGFEPDFVPKTVKYNRLRKEGRTRLLKMAGLMT
GRTYSESTFLIATSGRHEYRNKGLDLFLDTVAEIDSRIPEGSEALAFILVPGWVDRPSPS
LKAAMENGYGTVETDYLTHRLHNEDSDEVCVRIRQLADEGRFRNVKVIYVPCYLDGNDGI
IGISYYDILPAFDLTLFPSYYEPWGYTPLESVAFGVPTVTDNKAGFGQWVLDNFANGIDN
CGVKVVERNDSDYFNSRDEIVSAALAYQSSDPNARLHARNMAFLTSAKTDWKYFMAYYYE
AFGIALSKHGQEIKKQE

Enzyme Prediction     

EC	2.4.1.11

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GT3	18	353	2.6e-105	0.5416012558869702

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd03793	GT3_GSY2-like	2.26e-88	14	548	2	590	glycogen synthase GSY2 and similar proteins. Glycogen synthase, which is most closely related to the GT3 family of glycosyltransferases, catalyzes the transfer of a glucose molecule from UDP-glucose to a terminal branch of a glycogen molecule, a rate-limit step of glycogen biosynthesis. GSY2, the member of this family in S. cerevisiae, has been shown to possess glycogen synthase activity.
pfam05693	Glycogen_syn	8.57e-79	18	548	1	585	Glycogen synthase. This family consists of the eukaryotic glycogen synthase proteins GYS1, GYS2 and GYS3. Glycogen synthase (GS) is the enzyme responsible for the synthesis of -1,4-linked glucose chains in glycogen. It is the rate limiting enzyme in the synthesis of the polysaccharide, and its activity is highly regulated through phosphorylation at multiple sites and also by allosteric effectors, mainly glucose 6-phosphate (G6P).
COG0438	RfaB	2.60e-12	112	549	38	381	Glycosyltransferase involved in cell wall bisynthesis [Cell wall/membrane/envelope biogenesis].
cd03801	GT4_PimA-like	8.85e-09	205	532	105	355	phosphatidyl-myo-inositol mannosyltransferase. This family is most closely related to the GT4 family of glycosyltransferases and named after PimA in Propionibacterium freudenreichii, which is involved in the biosynthesis of phosphatidyl-myo-inositol mannosides (PIM) which are early precursors in the biosynthesis of lipomannans (LM) and lipoarabinomannans (LAM), and catalyzes the addition of a mannosyl residue from GDP-D-mannose (GDP-Man) to the position 2 of the carrier lipid phosphatidyl-myo-inositol (PI) to generate a phosphatidyl-myo-inositol bearing an alpha-1,2-linked mannose residue (PIM1). Glycosyltransferases catalyze the transfer of sugar moieties from activated donor molecules to specific acceptor molecules, forming glycosidic bonds. The acceptor molecule can be a lipid, a protein, a heterocyclic compound, or another carbohydrate residue. This group of glycosyltransferases is most closely related to the previously defined glycosyltransferase family 1 (GT1). The members of this family may transfer UDP, ADP, GDP, or CMP linked sugars. The diverse enzymatic activities among members of this family reflect a wide range of biological functions. The protein structure available for this family has the GTB topology, one of the two protein topologies observed for nucleotide-sugar-dependent glycosyltransferases. GTB proteins have distinct N- and C- terminal domains each containing a typical Rossmann fold. The two domains have high structural homology despite minimal sequence homology. The large cleft that separates the two domains includes the catalytic center and permits a high degree of flexibility. The members of this family are found mainly in certain bacteria and archaea.
cd03809	GT4_MtfB-like	7.91e-08	234	462	133	300	glycosyltransferases MtfB, WbpX, and similar proteins. This family is most closely related to the GT4 family of glycosyltransferases. MtfB (mannosyltransferase B) in E. coli has been shown to direct the growth of the O9-specific polysaccharide chain. It transfers two mannoses into the position 3 of the previously synthesized polysaccharide.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ANU62732.1	2.12e-199	13	546	8	541
ASB36772.1	2.12e-199	13	546	8	541
QQR09930.1	2.12e-199	13	546	8	541
AHF11803.1	2.25e-193	16	556	10	553
QCD35215.1	5.39e-192	13	555	8	550

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
4QLB_A	8.24e-64	18	555	50	645	StructuralBasis for the Recruitment of Glycogen Synthase by Glycogenin [Caenorhabditis elegans],4QLB_B Structural Basis for the Recruitment of Glycogen Synthase by Glycogenin [Caenorhabditis elegans],4QLB_C Structural Basis for the Recruitment of Glycogen Synthase by Glycogenin [Caenorhabditis elegans],4QLB_D Structural Basis for the Recruitment of Glycogen Synthase by Glycogenin [Caenorhabditis elegans]
4KQ1_A	1.78e-62	4	548	19	635	Crystalstructure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_B Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_C Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ1_D Crystal structure of yeast glycogen synthase in complex with uridine-5'-monophosphate [Saccharomyces cerevisiae FostersO],4KQ2_A Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_B Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_C Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO],4KQ2_D Glucose1,2cyclic phosphate bound activated state of Yeast Glycogen Synthase [Saccharomyces cerevisiae FostersO]
3NB0_A	4.77e-62	15	548	29	636	Glucose-6-Phosphateactivated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NB0_B Glucose-6-Phosphate activated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NB0_C Glucose-6-Phosphate activated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3NB0_D Glucose-6-Phosphate activated form of Yeast Glycogen Synthase [Saccharomyces cerevisiae],3RT1_A Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RT1_B Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RT1_C Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],3RT1_D Maltodextarn bound activated state form of yeast glycogen synthase isoform 2 [Saccharomyces cerevisiae],5SUL_A Inhibited state structure of yGsy2p [Saccharomyces cerevisiae S288C],5SUL_B Inhibited state structure of yGsy2p [Saccharomyces cerevisiae S288C]
6U77_A	4.90e-62	15	548	9	616	yGsy2pin complex with small molecule [Saccharomyces cerevisiae S288C],6U77_B yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_C yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C],6U77_D yGsy2p in complex with small molecule [Saccharomyces cerevisiae S288C]
5UX7_A	6.13e-62	15	548	29	636	Activatedstate yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_B Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_C Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C],5UX7_D Activated state yeast Glycogen Synthase in complex with UDP-xylose [Saccharomyces cerevisiae S288C]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
A2RRU1	3.76e-72	14	548	27	615	Glycogen [starch] synthase, muscle OS=Rattus norvegicus OX=10116 GN=Gys1 PE=1 SV=1
P13807	5.13e-72	14	548	27	615	Glycogen [starch] synthase, muscle OS=Homo sapiens OX=9606 GN=GYS1 PE=1 SV=2
Q9Z1E4	5.22e-72	14	548	27	615	Glycogen [starch] synthase, muscle OS=Mus musculus OX=10090 GN=Gys1 PE=1 SV=2
Q5R9H0	1.92e-71	14	548	27	615	Glycogen [starch] synthase, muscle OS=Pongo abelii OX=9601 GN=GYS1 PE=2 SV=1
A7MB78	2.62e-71	8	548	23	615	Glycogen [starch] synthase, muscle OS=Bos taurus OX=9913 GN=GYS1 PE=2 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000070	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000354_00437.