CAZyme Information: MGYG000000354_01068

Basic Information

• Species: CAG-485 sp001701295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp001701295
• CAZyme ID: MGYG000000354_01068
• CAZy Family: GH0
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
760		84055.27	5.3072

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000354	2905675	MAG	Sweden	Europe

• Gene Location: Start: 25222; End: 27504 Strand: -

Full Sequence      

MMLAGSAMAISAGATEREIFVQTDAYRWEGDTIYQNEFKAWADNPYQIRSTYKGRPGYFM
PVSQTWSRKNDLSAYPVLKGGNLLHQAIYNMGLDEMVNAVEPDTTLRTGKEWAGVWTRDV
SYSIILSMAALQPEASMISLMKKVNPSGQIIQDTGSGGAWPISTDRMIWTLAAYEIYKVT
GDKKWLEKVYPIALRSIEKDDLTIRSERGLVKGETSFIDWREQSYPKWMQTADISQSEAM
GTNVMYAAALKAVSEMASELGHKKTATEYAAKAEELSALIDKTFHMPDKGYYGMYTYGRD
NLILNPRAETLGEALAILYDIAPAERQKEISQSNPTTPFGPAIFYPQIADMPNYHNNALW
PFVASYWTLAQAKAGNEEGVVEGIGSVFRPAALFATNKENFNLDNGDIYTELNSSNMLWS
LSGNIALTQQILFGIHFEKDGLRIAPFVPEAFAAERTLENFPYRGARLDITVNGYGDKIK
SLTLNGKNLDPTKTIPAKALAKGGKITVEMANAPIAPMKINRVANLKAPLTPTAWMENSK
DIVATDGVSQNLLRWNPIEYIGEYIVLKDGREVARTRQTQFPAPTPGEWQVIGVAGDGTP
GFASEPRSNRTAIAVEFGDEITAMKSPEVSYQPKEELAGFYGAGFAETDRTTPARTVEID
IPADGIYSISVRYANGNGPVNTENKAAIRTLTVDGKKAGTLVMPHRGVANWNDWGMSNGV
KTDMKSGKHTVTIEYLPEDENMNINTNHALMDRVIVERVK

Enzyme Prediction     

No EC number prediction in MGYG000000354_01068.

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd04083	CBM35_Lmo2446-like	4.99e-15	638	739	21	114	Carbohydrate Binding Module 35 (CBM35) domains similar to Lmo2446. This family includes carbohydrate binding module 35 (CBM35) domains that are appended to several carbohydrate binding enzymes. Some CBM35 domains belonging to this family are appended to glycoside hydrolase (GH) family domains, including glycoside hydrolase family 31 (GH31), for example the CBM35 domain of Lmo2446, an uncharacterized protein from Listeria monocytogenes EGD-e. These CBM35s are non-catalytic carbohydrate binding domains that facilitate the strong binding of the GH catalytic modules with their dedicated, insoluble substrates. GH31 has a wide range of hydrolytic activities such as alpha-glucosidase, alpha-xylosidase, 6-alpha-glucosyltransferase, or alpha-1,4-glucan lyase, cleaving a terminal carbohydrate moiety from a substrate that may be a starch or a glycoprotein. Most characterized GH31 enzymes are alpha-glucosidases.
pfam17389	Bac_rhamnosid6H	3.53e-11	156	329	78	245	Bacterial alpha-L-rhamnosidase 6 hairpin glycosidase domain. This family consists of bacterial rhamnosidase A and B enzymes. L-Rhamnose is abundant in biomass as a common constituent of glycolipids and glycosides, such as plant pigments, pectic polysaccharides, gums or biosurfactants. Some rhamnosides are important bioactive compounds. For example, terpenyl glycosides, the glycosidic precursor of aromatic terpenoids, act as important flavouring substances in grapes. Other rhamnosides act as cytotoxic rhamnosylated terpenoids, as signal substances in plants or play a role in the antigenicity of pathogenic bacteria.
COG3408	GDB1	2.15e-08	112	378	281	555	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
cd04082	CBM35_pectate_lyase-like	1.67e-06	638	734	20	109	Carbohydrate Binding Module family 35 (CBM35), pectate lyase-like; appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. This family includes carbohydrate binding module family 35 (CBM35) domains that are non-catalytic carbohydrate binding domains that are appended mainly to enzymes that bind mannan (Man), xylan, glucuronic acid (GlcA) and possibly glucans. Included in this family are CBM35s of pectate lyases, including pectate lyase 10A from Cellvibrio japonicas, these enzymes release delta-4,5-anhydrogalaturonic acid (delta4,5-GalA) from pectin, thus identifying a signature molecule for plant cell wall degradation. CBM35s are unique in that they display conserved specificity through extensive sequence similarity but divergent function through their appended catalytic modules. They are known to bind alpha-D-galactose (Gal), mannan (Man), xylan, glucuronic acid (GlcA), a beta-polymer of mannose, and possibly glucans, forming four subfamilies based on general ligand specificities (galacto, urono, manno, and gluco configurations). In contrast to most CBMs that are generally rigid proteins, CBM35 undergoes significant conformational change upon ligand binding. Some CBM35s bind their ligands in a calcium-dependent manner, especially those binding uronic acids.
pfam06202	GDE_C	2.89e-06	163	379	82	319	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QEC58493.1	3.20e-212	62	756	195	874
AWG27199.1	3.22e-209	28	759	174	893
AKQ46615.1	1.74e-208	62	760	224	906
QTE38578.1	6.39e-208	55	759	203	889
AYA38918.1	7.27e-207	62	759	232	915

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

has no Swissprot hit.

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.519746	0.478263	0.000626	0.000909	0.000234	0.000222

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000354_01068.