CAZyme Information: MGYG000000354_01295

Basic Information

• Species: CAG-485 sp001701295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp001701295
• CAZyme ID: MGYG000000354_01295
• CAZy Family: GH133
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
654	MGYG000000354_14|CGC1	75065.64	6.5468

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000354	2905675	MAG	Sweden	Europe

• Gene Location: Start: 58784; End: 60748 Strand: +

Full Sequence      

MSYLKFDKNLMINLEQSLPKEMLRTNMSGAYHCTTIVGCNTRKQHGLLVIPIPEMDDKAH
VLLSSLDESVIQHGASFNLGLHQYGDNVFSPNGHKYIREFTCESVPKVTFRVGGVIMTKE
KVFISHENRILIKYTLIEAHSPKTLRFRPFLAFRNANDLVIENPRINKDIHHVPNGISTC
LYEGYPSLFMQFNKDAKWVDDPNWYKGIEYYKDRDRGIPYKEDLWVPGYFELPISKGESI
IFSASTFEADPKTFEHTYEAELKTRTCRTSFFNCLKNAAKQFYLKNEHGMYIVAGYPWLN
VRGRDELIALPGCTLAIDHEEDFHLILESFMKALRHNIETGEKDRIINEIDLPDIPLWTI
WAIDQYRKYTDTHRCAERYADTVRYLVDCIREGEIRNLTLHENGLLSSEGTDSPITWLSA
SINGSPIIPRTGYILEFNALWYNALMFLISMLEETKRDAGYAAELKTLADKCKESFVSTF
LNDFGYLYDYVNGSYTDLEVRPNMAIAIGLEYSPLDRRQRKKALDFCTRELLTPKGLRSL
SPKSHNYRPVYVGNPTEREYAVHQGPARPWLFGFYVDAYFKVFGVSGLSFIERMLIGYEE
EMSEGCIGSLSEMYDANPPYTGRGAVSTAKNVGQILSSIRAVNRMSKLLSETES

Enzyme Prediction     

No EC number prediction in MGYG000000354_01295.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH133	285	636	6e-88	0.9811827956989247

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam12439	GDE_N	2.97e-87	20	241	1	209	Glycogen debranching enzyme N terminal. This domain family is found in bacteria and archaea, and is typically between 218 and 229 amino acids in length. The family is found in association with pfam06202. Glycogen debranching enzyme catalyzes the debranching of amylopectin in glycogen. This is done by transferring three glucose subunits of glycogen from one parallel chain to another. This has the effect of enabling the glucose residues to become more accessible for glycolysis.
pfam06202	GDE_C	2.27e-77	278	636	2	373	Amylo-alpha-1,6-glucosidase. This family includes human glycogen branching enzyme AGL. This enzyme contains a number of distinct catalytic activities. It has been shown for the yeast homolog GDB1 that mutations in this region disrupt the enzymes Amylo-alpha-1,6-glucosidase (EC:3.2.1.33).
COG3408	GDB1	5.24e-55	20	639	5	603	Glycogen debranching enzyme (alpha-1,6-glucosidase) [Carbohydrate transport and metabolism].
TIGR01531	glyc_debranch	2.32e-14	303	578	1039	1393	glycogen debranching enzymye. glycogen debranching enzyme possesses two different catalytic activities; oligo-1,4-->1,4-glucantransferase (EC 2.4.1.25) and amylo-1,6-glucosidase (EC 3.2.1.33). Site directed mutagenesis studies in S. cerevisiae indicate that the transferase and glucosidase activities are independent and located in different regions of the polypeptide chain. Proteins in this model belong to the larger alpha-amylase family. The model covers eukaryotic proteins with a seed composed of human, nematode and yeast sequences. Yeast seed sequence is well characterized. The model is quite rigorous; either query sequence yields large bit score or it fails to hit the model altogether. There doesn't appear to be any middle ground. [Energy metabolism, Biosynthesis and degradation of polysaccharides]

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
AHF12310.1	1.56e-317	1	644	1	645
QCD36159.1	1.62e-313	1	645	1	645
BCI63386.1	1.37e-307	1	647	1	643
ASB36860.1	7.90e-307	1	627	1	627
ANU62650.1	7.90e-307	1	627	1	627

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
7EKU_A	3.42e-11	177	579	949	1441	ChainA, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EKU_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138]
5D06_A	7.76e-11	209	579	981	1441	CrystalStructure of the Candida Glabrata Glycogen Debranching Enzyme [[Candida] glabrata CBS 138],5D06_B Crystal Structure of the Candida Glabrata Glycogen Debranching Enzyme [[Candida] glabrata CBS 138]
5D0F_A	7.76e-11	209	579	981	1441	CrystalStructure of the Candida Glabrata Glycogen Debranching Enzyme (E564Q) in complex with maltopentaose [[Candida] glabrata CBS 138],5D0F_B Crystal Structure of the Candida Glabrata Glycogen Debranching Enzyme (E564Q) in complex with maltopentaose [[Candida] glabrata CBS 138]
7EIM_A	7.77e-11	209	579	981	1441	ChainA, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EIM_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EJP_A Chain A, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EJP_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EJT_A Chain A, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EJT_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138]
7EKW_A	7.77e-11	209	579	981	1441	ChainA, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138],7EKW_B Chain B, 4-alpha-glucanotransferase [[Candida] glabrata CBS 138]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q06625	4.98e-09	213	579	996	1450	Glycogen debranching enzyme OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=GDB1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000054	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000354_01295.