CAZyme Information: MGYG000000354_01297

Basic Information

• Species: CAG-485 sp001701295
• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Muribaculaceae; CAG-485; CAG-485 sp001701295
• CAZyme ID: MGYG000000354_01297
• CAZy Family: GH57
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
476	MGYG000000354_14|CGC1	54293.37	4.8397

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000354	2905675	MAG	Sweden	Europe

• Gene Location: Start: 62035; End: 63465 Strand: +

Full Sequence      

MKNVCFYFKIHQPYRLKRYRFFDIGNDHYYYDDFANDEIITRLAENSYIPMCDTLLDMIK
ENNGNFKCAISVSGTALEQLQNYVPEVVDRLKQLANTGCVEFLSGTFAHSLASLEDPEEF
IREVKLESDLIFRTLGVKTKTFANTELIYDDDIASMIYGMGFKACLTAGAKHVLGWKSPN
YVYSAASAPRLKLLLTNDKLSDDVARNFNNHEWLEYPLNADKYMDWIAALPEEEQVVNLY
LSMDTFGSFLPASTGIFQFMKALPRFAAERNIAFTTPLEVTSKLKSVGELSVPYPMSDID
EARDVSAWKGNSLQNEALAKLYGVAERVSLCNDRRLKQDWEYLQSSDHFYYMSTKNMADG
ASHAAFSPYDSPFAAFTNYMNVLADFLVRVEEQYPESIDNEELNSLLLTIRNQASEINSL
NKEVKTLRANILNDDTLTVVEAEEIAPKQTRKDTETKPAPRKRATRKTAKTKEEDK

Enzyme Prediction     

No EC number prediction in MGYG000000354_01297.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH57	6	322	1.7e-50	0.8067885117493473

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
cd10795	GH57N_MJA1_like	4.15e-155	3	311	1	306	N-terminal catalytic domain of a thermoactive alpha-amylase from Methanococcus jannaschii and similar proteins; glycoside hydrolase family 57 (GH57). The subfamily is represented by a thermostable alpha-amylase (MJA1, EC 3.2.1.1) encoded from the hyperthermophilic archaeon Methanococcus jannaschii locus, M J1611. MJA1 has a broad pH optimum 5.0-8.0. It exhibits extremely thermophilic alpha-amylase activity that catalyzes the hydrolysis of large sugar polymers with alpha-l,6 and alpha-l,4 linkages, and yields products including glucose polymers of 1-7 units. MJ1611 also encodes another alpha-amylase with catalytic features distinct from MJA1, which belongs to glycoside hydrolase family 13 (GH-13), and is not included here. This subfamily also includes many uncharacterized proteins found in bacteria and archaea.
pfam03065	Glyco_hydro_57	1.38e-62	6	293	2	293	Glycosyl hydrolase family 57. This family includes alpha-amylase (EC:3.2.1.1), 4--glucanotransferase (EC:2.4.1.-) and amylopullulanase enzymes.
COG1449	COG1449	3.13e-56	1	451	85	571	Alpha-amylase/alpha-mannosidase, GH57 family [Carbohydrate transport and metabolism].
cd01022	GH57N_like	1.40e-25	5	310	1	313	N-terminal catalytic domain of heat stable retaining glycoside hydrolase family 57. Glycoside hydrolase family 57(GH57) is a chiefly prokaryotic family with the majority of thermostable enzymes coming from extremophiles (many of these are archaeal hyperthermophiles), which exhibit the enzyme specificities of alpha-amylase (EC 3.2.1.1), 4-alpha-glucanotransferase (EC 2.4.1.25), amylopullulanase (EC 3.2.1.1/41), and alpha-galactosidase (EC 3.2.1.22). This family also includes many hypothetical proteins with uncharacterized activity and specificity. GH57s cleave alpha-glycosidic bonds by employing a retaining mechanism, which involves a glycosyl-enzyme intermediate, allowing transglycosylation.
cd10793	GH57N_TLGT_like	6.83e-12	6	161	2	135	N-terminal catalytic domain of 4-alpha-glucanotransferase; glycoside hydrolase family 57 (GH57). 4-alpha-glucanotransferase (TLGT, EC 2.4.1.25) plays a key role in the maltose metabolism. It catalyzes the disproportionation of amylose and the formation of large cyclic alpha-1,4-glucan (cycloamylose) from linear amylose. TLGT functions as a homodimer. Each monomer is composed of two domains, an N-terminal catalytic domain with a (beta/alpha)7 barrel fold and a C-terminal domain with a twisted beta-sandwich fold. Some family members have been designated as alpha-amylases, such as the heat-stable eubacterial amylase from Dictyoglomus thermophilum (DtAmyA) and the extremely thermostable archaeal amylase from Pyrococcus furiosus(PfAmyA). However, both of these proteins are 4-alpha-glucanotransferases. DtAmyA was shown to have transglycosylating activity and PfAmyA exhibits 4-alpha-glucanotransferase activity.

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
QCD36161.1	1.93e-218	1	435	1	435
QCD41434.1	7.68e-216	1	431	1	431
QCP71895.1	1.47e-214	1	431	1	431
QCD38208.1	1.47e-214	1	431	1	431
ANU62648.1	1.71e-211	1	435	1	437

PDB Hits     

has no PDB hit.

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
Q59006	3.47e-78	4	397	3	403	Putative alpha-amylase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) OX=243232 GN=MJ1611 PE=3 SV=1
O57932	4.95e-06	39	163	22	140	Alpha-amylase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) OX=70601 GN=amyA PE=3 SV=1

SignalP and Lipop Annotations

This protein is predicted as OTHER

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
1.000050	0.000000	0.000000	0.000000	0.000000	0.000000

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000354_01297.