CAZyme Information: MGYG000000355_00256

Basic Information

• Lineage: Bacteria; Bacteroidota; Bacteroidia; Bacteroidales; Tannerellaceae; Parabacteroides
• CAZyme ID: MGYG000000355_00256
• CAZy Family: GH146
• CAZyme Description: hypothetical protein

CAZyme Property

Protein Length	CGC	Molecular Weight	Isoelectric Point
681	MGYG000000355_4|CGC1	78371.77	4.9996

Genome Property

Genome Assembly ID	Genome Size	Genome Type	Country	Continent
MGYG000000355	2806154	MAG	Sweden	Europe

• Gene Location: Start: 8522; End: 10567 Strand: +

Full Sequence      

MNRIKTILLASMASVMVAQAGNEQEVVSGNYLNNRQPLLQKDYIELPLGAIRAEGWMQEQ
LIRMKEGMTGHLDKVYEHVMGARNGWLGGDGDVWERGPYWIDGLLPLAYILNDEALVEKI
KPWVEWALASQKPNGYFGPDTDRTPEPGLQRDNAHDWWPKMVMLKVLQQYYSATEDARVL
DFFTKYFKYQLAELPKTPLGHWTFWGEQRGGDNLMMVYWLYNITGDKFLLDLGELIHKQT
FNWTDVFLNQDHLSRQHSLHCVNLGQGFKEPVVYYQQNKDPKQIEAVESAVHQIHNTIGL
PTGLWGGDELLRFGRPTAGSELCTAVEMMYSLEEILEITGEVQWADYLERVAYNALPTQV
TDDYSARQYFQQFNQVRVTREWREFSTPHEDTDVVFGVLTGYPCCTSNLHQGWPKFVQNL
WYATADNGIAALVYAPSNVTAKVANGIAVNIQEKTNYPFDETIQFQVSFADKKVKQAFFP
FHVRIPAWCEHPVLKVNGTPIQTDAYSGQIARVNREWKAGDVLTLELPMEVTVSRWYDNG
AVVERGPLLYALKMNEKWEKKTMEPEKVREYGEWYYEVTSDTPWNYALSSRSFEPGKIQE
NFIVEKSDKIADYPWNIENAPITIKTKAKRLNNWTVVRGSAGPISFFTQQGNDMSDEAET
IELIPYGCTTLRIAEFPVRWY

Enzyme Prediction     

No EC number prediction in MGYG000000355_00256.

CAZyme Signature Domains

Family	Start	End	Evalue	family coverage
GH146	179	550	1.7e-35	0.6978131212723658

CDD Domains     

Cdd ID	Domain	E-Value	qStart	qEnd	sStart	sEnd	Domain Description
pfam07944	Glyco_hydro_127	2.97e-67	84	551	51	503	Beta-L-arabinofuranosidase, GH127. One member of this family, from Bidobacterium longicum, UniProtKB:E8MGH8, has been characterized as an unusual beta-L-arabinofuranosidase enzyme, EC:3.2.1.185. It rleases l-arabinose from the l-arabinofuranose (Araf)-beta1,2-Araf disaccharide and also transglycosylates 1-alkanols with retention of the anomeric configuration. Terminal beta-l-arabinofuranosyl residues have been found in arabinogalactan proteins from a mumber of different plantt species. beta-l-Arabinofuranosyl linkages with 1-4 arabinofuranosides are also found in the sugar chains of extensin and solanaceous lectins, hydroxyproline (Hyp)2-rich glycoproteins that are widely observed in plant cell wall fractions. The critical residue for catalytic activity is Glu-338, in a ET/SCAS sequence context.
COG3533	COG3533	4.19e-28	317	552	288	502	Uncharacterized conserved protein, DUF1680 family [Function unknown].

CAZyme Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End
ALL07583.1	4.69e-151	1	678	1	650
ATP55412.1	9.57e-151	1	678	1	650
AMP98056.1	1.24e-147	1	678	1	650
QNK64903.1	3.98e-145	31	678	22	644
ACU60445.1	1.11e-144	4	678	2	650

PDB Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
5MQO_A	1.09e-20	313	552	367	608	Glycosidehydrolase BT_1003 [Bacteroides thetaiotaomicron]
4QJY_A	5.64e-17	63	552	45	561	Crystalstructure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QJY_B Crystal structure of native Ara127N, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
4QK0_A	5.23e-16	63	552	45	561	Crystalstructure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_B Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_C Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus],4QK0_D Crystal structure of Ara127N-Se, a GH127 beta-L-arabinofuranosidase from Geobacillus Stearothermophilus T6 [Geobacillus stearothermophilus]
6EX6_A	1.63e-12	113	550	88	544	TheGH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482],6EX6_B The GH127, Beta-arabinofuranosidase, BT3674 [Bacteroides thetaiotaomicron VPI-5482]
6YQH_AAA	2.95e-11	223	535	229	542	ChainAAA, Acetyl-CoA carboxylase, biotin carboxylase [Bacteroides thetaiotaomicron VPI-5482]

Swiss-Prot Hits     

Hit ID	E-Value	Query Start	Query End	Hit Start	Hit End	Description
E8MGH8	9.00e-09	317	550	334	565	Non-reducing end beta-L-arabinofuranosidase OS=Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b) OX=565042 GN=hypBA1 PE=1 SV=1

SignalP and Lipop Annotations

This protein is predicted as SP

Other	SP_Sec_SPI	LIPO_Sec_SPII	TAT_Tat_SPI	TATLIP_Sec_SPII	PILIN_Sec_SPIII
0.000243	0.999064	0.000192	0.000177	0.000161	0.000140

TMHMM  Annotations     

There is no transmembrane helices in MGYG000000355_00256.